fam167a Antibody

What is FAM167A and why is it significant in biomedical research?

FAM167A (Family with Sequence Similarity 167 Member A) is a protein that has emerged as a critical factor in various cellular signaling pathways, particularly in disease contexts. Recent research has identified FAM167A as an essential molecule in BCR-ABL-independent tyrosine kinase inhibitor (TKI) resistance in chronic myeloid leukemia (CML) . The protein activates the noncanonical NF-κB pathway by binding to desmoglein-1 (DSG1), which subsequently upregulates NF-κB-inducing kinase (NIK) by blocking its ubiquitination . FAM167A has also been implicated in immune-related pathways and has shown associations with systemic sclerosis in genetic studies . Understanding this protein's functions provides valuable insights into disease mechanisms and potential therapeutic targets.

What types of FAM167A antibodies are available for research applications?

For researchers studying FAM167A, several antibody formats are available based on the experimental requirements. The most common type is the unconjugated polyclonal antibody raised in rabbit hosts, which recognizes human FAM167A . These antibodies are typically generated against recombinant proteins corresponding to specific amino acid sequences of FAM167A, such as: LRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFS . For research requiring high specificity, antibodies verified on protein arrays containing the target protein plus non-specific proteins are recommended to minimize cross-reactivity issues . Monoclonal antibodies against FAM167A are also utilized in studies requiring consistent antibody performance across experiments, though polyclonals may offer broader epitope recognition.

What are the validated applications for FAM167A antibodies?

FAM167A antibodies have been validated for multiple research applications, primarily:

• Western Blot analysis: For detecting FAM167A protein in cell and tissue lysates, allowing quantification of expression levels .

• Immunohistochemistry (IHC): Both on frozen sections and paraffin-embedded tissues, enabling localization studies of FAM167A in tissue contexts .

• Immunofluorescence (IF): For visualizing subcellular localization and co-localization with other proteins of interest .

• Flow cytometry: Particularly useful for analyzing FAM167A expression in specific cell populations, as demonstrated in studies examining CD34+ CML cells .

When selecting an antibody for a specific application, researchers should review validation data specific to their experimental system, as performance may vary across tissue types and experimental conditions.

How should researchers optimize Western blot protocols for FAM167A detection?

Optimizing Western blot protocols for FAM167A detection requires careful consideration of several parameters:

• Sample preparation: Effective protein extraction requires appropriate lysis buffers. For FAM167A analysis, researchers have successfully used nuclear fractionation protocols that involve centrifugation of nuclear lysates at 16,000×g for 5 minutes at 4°C .

• Gel selection: 8-15% SDS-polyacrylamide gels have been effectively used for FAM167A separation based on its molecular weight .

• Transfer and blocking: Transfer to polyvinylidene difluoride membranes followed by blocking with appropriate blocking buffer is recommended to minimize background .

• Antibody dilution: Optimal primary antibody dilutions should be determined empirically, typically starting at manufacturer recommendations (1:500-1:1000).

• Controls: Include positive controls (cells known to express FAM167A) and loading controls (GAPDH has been effectively used as an internal standard for densitometry) .

• Visualization: Quantify band intensity using software like ImageJ, normalizing to internal standards for accurate comparative analysis .

What considerations are important when using FAM167A antibodies for immunofluorescence studies?

When designing immunofluorescence experiments with FAM167A antibodies, researchers should consider:

• Fixation methods: Most protocols use 4% paraformaldehyde fixation, but optimization for specific cell types may be necessary.

• Antibody selection: For surface protein studies, antibodies targeting the extracellular domain are essential, as demonstrated in protocols examining FAM167A binding to surface DSG1 .

• Membrane permeabilization: For intracellular staining, appropriate permeabilization reagents (Triton X-100 or methanol) must be selected based on epitope location.

• Secondary antibody selection: For FAM167A, Alexa Fluor 488-conjugated secondary antibodies have been successfully used for visualization .

• Multiplexing considerations: For co-staining experiments, such as those examining CD34+ cells in CML patients, careful selection of compatible fluorophores is essential (e.g., PE-conjugated anti-CD34 and Alexa Fluor 488-conjugated anti-DSG1) .

• Controls: Include appropriate isotype controls and single-stained samples for accurate determination of positive signals.

How can researchers investigate FAM167A's role in noncanonical NF-κB pathway activation?

Investigating FAM167A's role in noncanonical NF-κB pathway activation requires multi-faceted approaches:

• Electrophoretic Mobility Shift Assay (EMSA): This technique enables assessment of NF-κB DNA binding activity. Protocols involve:

  • Incubating nuclear fractions with anti-p52 antibody or isotype control

  • Adding biotinylated double-stranded NF-κB probe (5′-AGTTGAGGGGACTTTCCCAGG-3′)

  • Separating samples on 6% non-denaturing polyacrylamide gels

  • Transferring to nylon membranes and visualizing using chemiluminescent detection kits

• Protein interaction studies: To investigate FAM167A's interaction with DSG1:

  • Co-immunoprecipitation assays to pull down protein complexes

  • Mass spectrometry analysis to identify binding partners

  • Microscopy-based co-localization studies

• Functional studies:

  • Assess NIK ubiquitination status in the presence/absence of FAM167A

  • Measure nuclear translocation of p52 (processed form of p100) as an indicator of noncanonical NF-κB pathway activation

  • Evaluate expression of NF-κB target genes using qRT-PCR with primers specific to genes regulated by this pathway

What methodologies are effective for studying FAM167A in drug resistance mechanisms?

Researchers investigating FAM167A's role in drug resistance mechanisms, particularly in the context of TKI resistance in CML, should consider these methodological approaches:

• Cell line models: Establish TKI-resistant and TKI-sensitive cell lines for comparative studies. Measure FAM167A expression levels using qRT-PCR with validated primers:

  • FAM167A-F: 5′-GCACAGTGAACACAACTAACC-3′

  • FAM167A-R: 5′-CTTGGGGATGGCAGAGAGAT-3′

• Patient-derived samples: Analyze CD34+ cells from CML patients with BCR-ABL-independent TKI resistance compared to responsive patients using flow cytometry with dual staining for CD34 and FAM167A .

• Functional manipulation:

  • Knockdown studies using siRNA/shRNA

  • Overexpression studies with tagged FAM167A constructs

  • FAM167A neutralization experiments using specific antibodies

• In vivo models: Mouse tumor models can assess the efficacy of FAM167A neutralization in restoring TKI sensitivity, providing translational evidence for potential therapeutic approaches .

• Pathway analysis: Combine with inhibitors of the noncanonical NF-κB pathway to determine if FAM167A-induced resistance can be overcome.

How should researchers design genetic association studies investigating FAM167A polymorphisms?

When designing genetic association studies to investigate FAM167A polymorphisms in disease contexts such as systemic sclerosis:

• Population selection: Define clear inclusion/exclusion criteria for case and control groups. For example, in the Chinese Han population study, a cohort of 248 SSc patients and 251 healthy controls was used .

• SNP selection strategy: Choose single nucleotide polymorphisms (SNPs) based on:

  • Previous association data

  • Linkage disequilibrium patterns

  • Functional prediction (coding regions, regulatory elements)

  • Population-specific allele frequencies

• Genotyping methodology: The MassARRAY system based on matrix-assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS) provides high-throughput, accurate genotyping .

• Statistical analysis:

  • Calculate odds ratios (OR) with 95% confidence intervals

  • Apply appropriate corrections for multiple testing

  • Consider haplotype analyses and gene-gene interactions

  • Perform subgroup analyses based on clinical phenotypes

• Validation studies: Independent replication in different cohorts is essential to confirm genetic associations.

How can researchers troubleshoot non-specific binding issues with FAM167A antibodies?

Non-specific binding is a common challenge when working with antibodies. For FAM167A antibodies, consider these troubleshooting approaches:

• Antibody validation: Verify antibody specificity using:

  • Protein arrays containing the target protein plus non-specific proteins (at least 383 other proteins in validated systems)

  • Positive and negative control samples

  • Competition assays with recombinant FAM167A protein

• Protocol optimization:

  • Increase blocking stringency (5% BSA or 5% milk in PBS-T)

  • Optimize antibody dilutions (perform titration experiments)

  • Increase wash steps duration and frequency

  • Reduce primary antibody incubation time

• Sample preparation:

  • Pre-clear lysates with Protein A/G beads

  • Pre-absorb antibodies with tissues/cells lacking the target

  • Add non-ionic detergents to reduce hydrophobic interactions

• Alternative approaches:

  • Try monoclonal antibodies if polyclonals show high background

  • Consider antibodies raised against different epitopes

  • Use tagged recombinant FAM167A constructs when possible

What criteria should be used to interpret FAM167A expression data in patient samples?

When analyzing FAM167A expression in patient samples, particularly in the context of disease mechanisms like TKI resistance in CML:

• Standardization protocols:

  • Use consistent sample collection and processing methods

  • Include appropriate reference genes for qRT-PCR (GAPDH has been validated)

  • Apply standardized gating strategies for flow cytometry analysis

• Quantification methods:

  • For Western blot: Use densitometry with appropriate normalization to loading controls

  • For qRT-PCR: Apply the ΔΔCt method with validated reference genes

  • For flow cytometry: Report data as mean fluorescence intensity (MFI) or percent positive cells

• Statistical considerations:

  • Determine appropriate sample sizes through power analysis

  • Apply non-parametric tests for small sample sizes or non-normally distributed data

  • Use paired tests when comparing matched samples

• Clinical correlation:

  • Correlate FAM167A expression with clinical outcomes (e.g., TKI response in CML)

  • Consider multivariate analyses to account for confounding factors

  • Establish clinically relevant cut-off values when possible

What emerging technologies could enhance FAM167A research?

Several cutting-edge technologies hold promise for advancing FAM167A research:

• CRISPR-Cas9 gene editing:

  • Generate FAM167A knockout cell lines for loss-of-function studies

  • Create point mutations to study the effects of specific variants

  • Develop knock-in reporter systems for live-cell imaging

• Single-cell technologies:

  • Apply single-cell RNA sequencing to identify FAM167A-expressing subpopulations

  • Use CyTOF (mass cytometry) for high-dimensional protein analysis

  • Implement spatial transcriptomics to map FAM167A expression in tissue contexts

• Structural biology approaches:

  • Cryo-electron microscopy to elucidate FAM167A-DSG1 binding interfaces

  • X-ray crystallography of FAM167A alone or in complex with interaction partners

  • Hydrogen-deuterium exchange mass spectrometry to study conformational dynamics

• Drug development technologies:

  • High-throughput screening for FAM167A inhibitors

  • Fragment-based drug discovery approaches

  • Structure-based virtual screening for novel compounds targeting FAM167A

How might FAM167A antibodies be used in translational research applications?

FAM167A antibodies have significant potential in translational research:

• Biomarker development:

  • Diagnostic assays for identifying patients with BCR-ABL-independent TKI resistance

  • Prognostic markers for predicting treatment response in CML

  • Companion diagnostics for emerging FAM167A-targeted therapies

• Therapeutic approaches:

  • Neutralizing antibodies as potential therapeutics to restore TKI sensitivity

  • Antibody-drug conjugates for targeted delivery to FAM167A-expressing cells

  • CAR-T cell therapy targeting surface-expressed FAM167A (if confirmed)

• Monitoring methods:

  • Liquid biopsy assays to detect circulating FAM167A protein

  • Immunohistochemistry panels for patient stratification

  • Multiplexed imaging approaches for personalized medicine

• Combinatorial strategies:

  • FAM167A targeting combined with TKI therapy

  • Dual inhibition of FAM167A and noncanonical NF-κB pathway components

  • Immunomodulatory approaches based on FAM167A's role in immune signaling