FAM174B (Family With Sequence Similarity 174 Member B) is a membrane protein essential for maintaining Golgi structural integrity . Its antibody, commonly used in research settings, facilitates the detection and study of FAM174B expression in various cellular contexts. Below is a detailed analysis of FAM174B antibodies, their specifications, tissue expression patterns, and research applications, drawing from diverse sources.
FAM174B exhibits cytoplasmic and membranous expression across most tissues, including:
Digestive System: Esophagus, colon, duodenum, liver
Reproductive System: Ovary, prostate
| Tissue | Expression Level |
|---|---|
| Esophagus | High |
| Liver | Moderate |
| Brain | Low |
CRISPR Screens: FAM174B has been implicated in 13 screens (out of 1,290) across diverse cancer models, suggesting roles in cellular viability and tumor biology .
Golgi Function: Studies highlight FAM174B’s role in maintaining organelle structure, with knockdown leading to Golgi fragmentation .
Biomarker Potential: Its downregulation in esophageal squamous cell carcinoma (ESCC) tissues (via FAM175B homologs) suggests diagnostic utility .
Validating FAM174B antibody specificity requires a multi-pronged approach to address potential cross-reactivity and confirm target engagement. First, utilize over-expression lysate controls (e.g., Boster Bio’s FAM174B lysate in HEK293T cells) to serve as a positive control for Western blot or immunoprecipitation assays . This ensures the antibody binds the recombinant protein. Second, cross-reference results with the Human Protein Atlas (HPA) dataset, which includes immunohistochemistry (IHC) and immunofluorescence (IF) data from 44 normal tissues and 20 cancer types . Tissue-specific expression patterns (e.g., epithelial or stromal localization) can help confirm genuine signals. For advanced validation, perform peptide blocking assays using the immunogen sequence (SGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDEDSTVFDIKYR) to demonstrate specificity.
Conflicting results often arise from differences in experimental conditions or sample preservation. For IHC, optimize antigen retrieval protocols (e.g., citrate buffer pH 6.0 vs. EDTA pH 9.0) to unmask epitopes in formalin-fixed paraffin-embedded (FFPE) tissues. In IF, ensure consistent fixation times (e.g., 10–15 minutes with 4% PFA) to preserve subcellular localization. Compare findings with HPA’s subcellular localization data to distinguish true signals from artifacts. For advanced troubleshooting, employ orthogonal validation using RNA FISH or CRISPR knockout cell lines to confirm protein expression at the genomic or transcriptomic level.
Multi-plex assays require stringent optimization to prevent cross-reactivity. For IHC, use species-specific secondary antibodies (e.g., rabbit-specific IgG) to avoid false positives when combining FAM174B with other rabbit-derived antibodies. In IF, employ sequential staining with signal amplification (e.g., TSA systems) to enhance weak signals while maintaining specificity. Validate antibody compatibility using negative controls (e.g., isotype-matched IgG) and single-stain controls to assess background noise. For advanced workflows, consider antibody conjugation (e.g., Alexa Fluor dyes) to enable multiplexing without spectral overlap.
Interpreting subcellular localization requires correlating IF data with functional studies. The HPA project reports FAM174B localization in membrane or cytoplasmic compartments , but experimental conditions (e.g., cell fixation method) can influence observed patterns. For robust analysis, compare results across multiple cell lines (e.g., HEK293T, MCF7) and validate with co-localization markers (e.g., EEA1 for endosomes, LAMP1 for lysosomes). Advanced studies may employ live-cell imaging or subcellular fractionation (e.g., membrane vs. cytosol) to confirm localization.
FAM174B antibody is critical for studying tumor microenvironment interactions and metastatic potential. In IHC, it can map protein expression in epithelial vs. stromal compartments to assess tumor progression . For functional studies, combine antibody staining with immune cell markers (e.g., CD8+ T cells, PD-1) to explore immune evasion mechanisms. Advanced applications include single-cell spatial profiling to resolve FAM174B expression gradients in tumor niches.
Batch variability is mitigated through rigorous titration and internal controls. For each new antibody lot, perform dose-response curves in IHC (1:50–1:200 dilution range) or IF (0.25–2 μg/mL) to establish optimal working concentrations. Include reference samples (e.g., HPA-validated tissues) in each experiment to normalize staining intensity. Advanced labs may employ antibody dilution arrays to systematically compare performance across lots.
To elucidate FAM174B’s functional role, integrate genetic and biochemical approaches. Use CRISPR knockout cell lines to assess phenotypic changes (e.g., migration, proliferation) and validate results with antibody-based Western blot or IF. For in vivo studies, employ FAM174B-deficient animal models alongside antibody staining to correlate protein loss with tissue-level outcomes. Advanced studies may leverage single-cell RNA-seq to identify FAM174B-regulated pathways.
Weak signals in FFPE samples often stem from incomplete antigen retrieval. Optimize protocols by testing different retrieval buffers (e.g., citrate vs. TRIS-EDTA) and incubation times (e.g., 20–40 minutes). For advanced troubleshooting, employ antigen retrieval with protease digestion (e.g., proteinase K) to enhance epitope exposure. Validate signal integrity using adjacent sections stained with HPA-validated antibodies as positive controls .
High-throughput applications face challenges with signal-to-noise ratios and cross-reactivity. Address these by pre-screening antibody performance in pilot studies and normalizing data using automated image analysis software. Advanced strategies include multiplexed antibody panels with orthogonal markers to reduce false positives. Note that FAM174B’s low expression in certain tissues may limit its utility in screens requiring broad detection.
Integrate antibody data with RNA-seq or proteomics by correlating FAM174B protein expression with gene modules or pathway activity. For example, identify co-expressed genes using weighted gene co-expression network analysis (WGCNA) and validate interactions via ChIP-seq or IP-MS. Advanced approaches may involve spatial transcriptomics to map FAM174B protein localization to transcriptional landscapes.