At4g29420 Antibody
Description
Target Protein: At4g29420 in Arabidopsis thaliana
The At4g29420 gene encodes an acid phosphatase-like protein belonging to the HAD (haloacid dehalogenase) superfamily, subfamily IIIB. Key features include:
| Property | Detail |
|---|---|
| UniProt ID | Q9M0E1 |
| Protein Length | 256 amino acids |
| Function | Putative phosphatase activity; role in metabolic pathways under study |
| Gene Expression | Ubiquitous in plant tissues, with potential stress-responsive roles |
This protein is implicated in phosphate metabolism, though its exact biological role remains under investigation .
Key Product Data
| Vendor | Product Code | Target Region | Host Species | Clonality | Applications | Price (USD) |
|---|---|---|---|---|---|---|
| Abmart | X-Q9M0F4-N | N-terminus | Mouse | Monoclonal | ELISA, Western Blot | $599 |
| Abmart | X-Q9M0F4-C | C-terminus | Mouse | Monoclonal | ELISA, Western Blot | $599 |
| Cusabio | CSB-PA864911XA01DOA | Full-length | Rabbit | Polyclonal | ELISA, IHC | $599+ |
Antigen Sequences:
-
N-terminus: MTFSRSSSITFFIVALFTVLINPAISSRAASFIKLPRSSIASYCESWRLAAETNNVGPWKVIPSQCENYIKNYINGGQFDKDYDVVASYAIDYAKTVKVGGDGKDAWVFDIDETLLSNIEYYKANGYGSEPYDSIKYNEVVEKGKDPGYDASLRLYKALKKLGFTIILLTGRDEGHRSVTEKNLRDAGYFGWNRLLLRGQNDQGKTATQYKSEQRSQVVKEGYTIHGNTGDQWSDLLGFAVASRSFKVPNPMYYVA
Research Applications
At4g29420 antibodies are primarily used to:
-
Localize the protein in plant tissues via immunohistochemistry (IHC).
-
Quantify expression levels under stress conditions (e.g., phosphate deprivation) using Western blot or ELISA .
-
Study post-translational modifications through immunoprecipitation assays.
Recent studies have linked At4g29420 to meiosis-specific processes in Arabidopsis, though direct mechanistic insights require further investigation .
Validation and Performance
-
Sensitivity: Detects 1 ng of target protein in Western blot .
-
Specificity: No cross-reactivity observed with homologous proteins in the HAD superfamily .
-
Commercial Guarantees: Abmart’s "AbInsure™" program offers replacement guarantees for failed applications .
Future Directions
Open research questions include:
-
Elucidating the protein’s role in phosphate signaling.
-
Characterizing its interaction partners using co-immunoprecipitation.
-
Developing transgenic Arabidopsis lines with At4g29420 knockouts to assess phenotypic impacts.
Product Specs
Composition: 50% Glycerol, 0.01M PBS, pH 7.4
Q&A
Here’s a structured collection of FAQs tailored for researchers working with the At4g29420 Antibody in academic settings, integrating experimental design, data analysis, and methodological insights from peer-reviewed studies:
Advanced Research FAQs
What computational tools can predict At4g29420-antibody binding affinities?
-
Tools:
-
Validation: Combine computational predictions with surface plasmon resonance (SPR) to measure binding kinetics (e.g., ) .
How can antibody affinity maturation be engineered for At4g29420?
-
Workflow:
-
Pitfalls: Avoid over-stabilizing the closed S-trimer conformation, which reduces epitope accessibility .
Which data analysis methods improve reproducibility in antibody-antigen studies?
-
ELISA-R: An R-based tool that reduces variability by modeling curve slopes and baseline signals (vs. traditional endpoint titration) .
| Parameter | Traditional ET | ELISA-R |
|---|---|---|
| Variability | High | Low |
| Dilution Sensitivity | O.D. 50 cutoff | Full-curve analysis |
| Statistical Power | Moderate | High (ANOVA ) |
