FZD10 Antibody

What is FZD10 and what are its key structural characteristics?

FZD10 (frizzled class receptor 10) is a 65.3 kDa cell surface receptor belonging to the frizzled gene family, encoded by chromosome 12q24.33 in humans. The protein consists of 581 amino acids with several distinctive structural features:

• A seven-transmembrane domain architecture

• An N-terminal cysteine-rich domain (CRD) that serves as the binding site for Wnt ligands

• A C-terminal Ser/Thr-Xxx-Val motif

The protein may also be known by alternative names including CD350, FZ-10, Fz10, FzE7, frizzled-10, and "frizzled 10, seven transmembrane spanning receptor" .

What types of anti-FZD10 antibodies are currently available for research?

Current research databases reveal over 299 distinct FZD10 antibodies from 25 suppliers, with various formats and applications:

For specific experimental needs, researchers should evaluate antibodies based on validated applications, species reactivity, and the target epitope region .

What are the optimal applications for anti-FZD10 antibodies and their validated protocols?

Anti-FZD10 antibodies have been validated for multiple applications with specific protocols for each:

Immunohistochemistry (IHC-P):

• Recommended dilution range: 1:20-1:50

• Suggested positive controls: Placenta, fetal kidney tissues

• Protocol optimization: Antigen retrieval using citrate buffer (pH 6.0) is typically required

Immunofluorescence (IF):

• Optimal concentration: 0.25-2 μg/mL

• Recommended fixation: 4% paraformaldehyde for 15 minutes

• Counterstaining: DAPI for nuclear visualization

Flow Cytometry:

• Starting concentration: 1-5 μg per 10^6 cells

• Recommended blocking: 2-5% BSA in PBS for 30 minutes

• Best results seen with unfixed or mildly fixed cells

How should researchers validate the specificity of anti-FZD10 antibodies?

A multi-step validation approach is recommended:

• Positive and negative controls:

  • Positive: Cell lines with known FZD10 expression (HeLa S3, SW480)

  • Negative: Cell lines with minimal FZD10 expression

• Peptide competition assays:

  • Pre-incubate antibody with immunogen peptide

  • Observe signal elimination in positive samples

• Multiple antibody comparison:

  • Use antibodies targeting different FZD10 epitopes

  • Confirm concordant staining patterns

• Genetic validation:

  • CRISPR/Cas9 knockout or siRNA knockdown of FZD10

  • Verify signal reduction following genetic manipulation

What is the expression pattern of FZD10 in normal and cancer tissues?

FZD10 exhibits a distinctive expression pattern across tissues:

Normal tissues:

• High expression: Placenta, fetal kidney

• Moderate expression: Fetal brain, fetal lung

• In adults: Primarily cerebellum, low levels in brain regions (frontal lobe, temporal lobe, putamen)

• Minimal expression: Heart, lung, skeletal muscle

Cancer tissues:

• High expression: Synovial sarcoma (therapeutic target)

• Moderate to high: Cervical cancer cell lines (HeLa S3)

• Moderate: Colon cancer cells (SW480)

• Notable expression: Nasopharyngeal carcinoma

This differential expression pattern makes FZD10 a potential biomarker and therapeutic target in certain cancers.

How does FZD10 function within Wnt signaling pathways?

FZD10 operates through multiple signaling mechanisms:

• Canonical Wnt/β-catenin pathway:

  • FZD10 acts as a receptor for Wnt proteins

  • Leads to activation of disheveled proteins

  • Inhibits GSK-3 kinase activity

  • Promotes nuclear accumulation of β-catenin

  • Activates downstream Wnt target genes

• Non-canonical signaling:

  • FZD10 enhances phosphorylation of Dishevelled 2 (Dvl2) and Dishevelled 3 (Dvl3)

  • Triggers the Rac1-JNK (Jun amino-terminal kinases) signaling pathway

  • Results in actin cytoskeleton rearrangement

  • Promotes anchorage-independent cell growth

• Lung-specific signaling:

  • In lung airway epithelium, FZD10 may be crucial for transferring Wnt7b signals

  • FZD10-Wnt7b combination enhances β-catenin concentration in transfected cells

How are anti-FZD10 antibodies being developed for cancer therapeutics?

Anti-FZD10 antibodies have shown significant potential in targeted cancer therapy, particularly for synovial sarcoma:

• Radioimmunotherapy approaches:

  • β-emitter therapy: A phase 1 trial using 90Y-labeled anti-FZD10 antibody (OTSA101) demonstrated stability in some patients with recurrent synovial sarcoma

  • α-emitter therapy: 225Ac-labeled OTSA101 showed superior tumor targeting with a 60% complete response rate in mouse models

  • Comparison studies indicate that the biologically effective dose (BED) of 225Ac-labeled OTSA101 for tumors was 7.8 times higher than 90Y-labeled OTSA101

• Antibody-drug conjugates:

  • Patent documentation reveals development of anti-FZD10 monoclonal antibodies conjugated to cytotoxic agents

  • These utilize antibody-dependent cellular cytotoxicity (ADCC) mechanisms and targeted toxin delivery

What recent advances have been made in drug discovery targeting FZD10?

Recent research has identified potential repurposed drugs that may target FZD10:

• Virtual screening approach:

  • Homology modeling of human FZD10's tertiary structure

  • Virtual screening of 1,094 FDA-approved drugs identified 17 potential inhibitors

  • Four compounds (prazosin, rilpivirine, doxazosin, and nicergoline) demonstrated significant cytotoxicity against nasopharyngeal carcinoma cells

  • Molecular dynamics simulations confirmed stable binding of these drugs to FZD10

These findings suggest new therapeutic avenues for cancers overexpressing FZD10 and potential drug repurposing strategies.

What are common challenges when working with anti-FZD10 antibodies and how can they be addressed?

Researchers frequently encounter several issues when working with anti-FZD10 antibodies:

• Cross-reactivity with other frizzled family members:

  • Solution: Use antibodies targeting unique epitopes of FZD10, particularly in the C-terminal region which shows less homology

  • The immunogen sequence "KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV" has been validated for specificity

• Variable detection in tissue samples:

  • Challenge: Heterogeneous expression and post-translational modifications

  • Approach: Optimize antigen retrieval methods (test both citrate and EDTA-based buffers)

  • Consider dual-staining approaches with other Wnt pathway markers for confirmation

• Batch-to-batch variability:

  • Recommendation: Purchase sufficient quantity for complete studies

  • Document lot numbers and include internal positive controls in each experiment

  • For polyclonal antibodies, consider pooling from multiple bleeds for consistent results

How should researchers design controls for FZD10 antibody validation?

A comprehensive control strategy includes:

• Positive tissue controls:

  • Placenta and fetal kidney tissues (high endogenous expression)

  • Synovial sarcoma tissues (pathological overexpression)

• Negative controls:

  • Isotype controls matched to the primary antibody

  • Secondary antibody-only controls

  • FZD10-negative or low-expressing tissues (adult heart, lung)

• Expression validation controls:

  • Parallel qRT-PCR for FZD10 mRNA expression

  • Western blotting with antibodies targeting different epitopes

  • Epitope blocking with immunizing peptide when available

What emerging research areas are utilizing FZD10 antibodies?

Several cutting-edge research directions are leveraging FZD10 antibodies:

• Single-cell analysis of FZD10 expression:

  • Application of FZD10 antibodies in single-cell proteomics

  • Correlation with transcriptomic data to understand regulation

  • Mapping heterogeneity of FZD10 expression in tumor microenvironments

• Bispecific antibody development:

  • Creation of bispecific antibodies targeting both FZD10 and immune checkpoint proteins

  • Potential to combine targeted therapy with immune activation

  • Early development reported in patent literature

• Functional studies of FZD10 in cancer stem cells:

  • Investigation of FZD10's role in cancer stemness

  • Development of antibody-based sorting strategies

  • Therapeutic targeting of cancer stem cell populations through FZD10

How might understanding FZD10 signaling specificity improve therapeutic antibody development?

Research into FZD10 signaling specificity offers promising avenues for more targeted therapeutics:

• Wnt ligand-specific interactions:

  • Characterizing which specific Wnt ligands preferentially bind FZD10

  • Developing antibodies that block specific FZD10-Wnt interactions

  • Creating conditional blocking antibodies active only in specific signaling contexts

• Pathway-selective inhibition:

  • Developing antibodies that selectively inhibit canonical versus non-canonical signaling

  • Creating epitope-specific antibodies that target functional domains of FZD10

  • Enabling more precise modulation of downstream effects

Understanding these specificities could lead to more precise therapeutic antibodies with reduced off-target effects and enhanced efficacy in cancer treatment.