slc37a2 Antibody

What is SLC37A2 and what is its biological function?

SLC37A2 is a member of the solute carrier family 37, which consists of four sugar-phosphate exchangers (A1-A4) anchored in the endoplasmic reticulum (ER) membrane . It functions primarily as an inorganic phosphate and glucose-6-phosphate antiporter, transporting cytoplasmic glucose-6-phosphate into the ER lumen while translocating inorganic phosphate in the opposite direction . Unlike some other family members, SLC37A2's activity appears to be independent of lumenal glucose-6-phosphatase and may not play a significant role in homeostatic regulation of blood glucose levels . The protein is also known as SPX2 and was initially identified in studies investigating cAMP-inducible genes involved in cholesterol efflux from macrophages .

What are the structural characteristics of SLC37A2?

SLC37A2 is an N-terminal glycosylated protein with 12 transmembrane spanning domains . The human SLC37A2 gene maps to chromosome 11q24.2 and encodes 4 transcripts generated by alternative splicing of 18 coding exons . The longest isoform consists of 505 amino acids with a calculated molecular weight of approximately 55 kDa, though the observed molecular weight on Western blots ranges from 50-75 kDa, likely due to post-translational modifications including N-linked glycosylation . The protein exists as two naturally occurring splice variants (isoforms 1 & 2) that differ by five amino acids in their extreme C-terminus, with isoform 2 harboring a canonical lysosomal sorting signal (YxxØ) while isoform 1 possesses an alternative targeting motif .

In which tissues and cells is SLC37A2 predominantly expressed?

SLC37A2 displays the highest transcript abundance in neutrophils and macrophages among the four SLC37 family members, suggesting a crucial role in innate immune function . The expression of SLC37A2 increases markedly during differentiation of THP-1 human monocytes to macrophages . Recent research has also identified significant SLC37A2 expression in osteoclasts, where it localizes to specialized secretory lysosomes and regulates bone metabolism . Additionally, elevated SLC37A2 expression has been observed in smooth muscle cells in adenine-induced chronic kidney disease rat models, suggesting potential involvement in vascular calcification processes .

What factors should be considered when selecting an SLC37A2 antibody?

When selecting an SLC37A2 antibody, researchers should consider:

• Target specificity: Verify the antibody recognizes the desired epitope within SLC37A2. For example, antibody ab223048 targets a recombinant fragment within the first 100 amino acids of human SLC37A2 , while HPA014948 targets the sequence "RKPISIVKSRLHQNCSEQIKPINDTHSLNDTMWCSWAPFDKDNYKE" .

• Species reactivity: Confirm the antibody reacts with your species of interest. Available antibodies show reactivity with various combinations of human, mouse, and rat samples .

• Application compatibility: Ensure the antibody is validated for your intended applications. Commercial SLC37A2 antibodies are available for Western blot (WB), immunohistochemistry on paraffin-embedded sections (IHC-P), immunocytochemistry/immunofluorescence (ICC/IF), and indirect ELISA .

• Clonality: Both monoclonal and polyclonal antibodies are available, each with different advantages. Most of the documented SLC37A2 antibodies are polyclonal rabbit antibodies .

How can the specificity of an SLC37A2 antibody be validated?

To validate the specificity of an SLC37A2 antibody:

• Western blot analysis: Verify the antibody detects a band of the expected molecular weight (approximately 55 kDa). For example, antibody ab223048 detects a band at 55 kDa in HepG2, HeLa, and mouse stomach tissue lysates , while Proteintech's 20469-1-PBS antibody detects bands between 50-75 kDa .

• Knockout/knockdown controls: Compare antibody staining between wild-type samples and those with reduced or absent SLC37A2 expression. Studies have demonstrated >95% reduction in Slc37a2 mRNA in homozygous knockout mice compared to wild-type littermates, which can serve as negative controls .

• Co-localization studies: Verify that the antibody's staining pattern aligns with known subcellular localization. For example, SLC37A2 should co-localize with markers of the endoplasmic reticulum or with lysosomal markers like LAMP2 in specific cell types like osteoclasts .

• Multiple antibody comparison: Use antibodies targeting different epitopes of SLC37A2 to confirm consistent patterns of expression and localization.

What are the recommended working dilutions for different applications?

Based on the search results, the following working dilutions have been reported:

Optimal dilutions should be determined empirically for each specific application and sample type.

How can SLC37A2 be studied in the context of bone metabolism?

SLC37A2 has been identified as a physiological component of the osteoclast's unique secretory organelle and a potential therapeutic target for metabolic bone diseases . To study SLC37A2 in bone metabolism:

• Immunolocalization studies: Use SLC37A2 antibodies in conjunction with markers for secretory lysosomes (SLs) like LAMP2 to study its subcellular distribution in osteoclasts . High-resolution imaging reveals that SLC37A2 localizes to a dynamic tubulo-vesicular network in osteoclasts .

• Live cell imaging: Express fluorescently tagged SLC37A2 isoforms (e.g., emGFP-SLC37A2 isoform 2 or mCherry-SLC37A2 isoform 1) to track its dynamics in live osteoclasts. This approach has revealed that SLC37A2 co-occupies an expansive network of highly dynamic tubulo-vesicular compartments that are acidic and contain cathepsins .

• Functional studies with knockout models: Use Slc37a2 knockout mice to assess the impact on bone structure and metabolism. While Slc37a2KO mice show no obvious abnormality in skeletal patterning at 5 days of age, detailed micro-CT analysis can reveal more subtle phenotypes in adult mice .

• Co-localization with functional markers: Use acidophilic probes like LysoTracker Red and cathepsin fluorescent substrates (DQ-BSA, Magic Red) alongside SLC37A2 antibodies to assess the functional properties of SLC37A2-positive compartments .

What methods are effective for studying SLC37A2 in immune cells?

Given the high expression of SLC37A2 in neutrophils and macrophages , several approaches can be employed:

• Expression analysis during differentiation: Monitor SLC37A2 expression during monocyte-to-macrophage differentiation using quantitative PCR and Western blotting. SLC37A2 expression increases markedly during differentiation of THP-1 human monocytes to macrophages .

• Co-expression studies: Examine the relationship between SLC37A2 expression and markers of macrophage activation or polarization to understand its role in different immune contexts.

• Functional transport assays: Assess the Pi-linked G6P antiporter activity of SLC37A2 in immune cells using radiolabeled substrates or fluorescent glucose analogs. SLC37A2 catalyzes G6P:Pi and Pi:Pi exchanges, and importantly, its antiport activity is insensitive to chlorogenic acid inhibition, which distinguishes it from other transporters .

• Cholesterol efflux assays: Since SLC37A2 was initially identified in relation to cholesterol efflux from macrophages via apoE and apoA1 , measure cholesterol efflux rates in cells with modulated SLC37A2 expression.

What are effective methods for subcellular localization studies of SLC37A2?

To accurately determine the subcellular localization of SLC37A2:

• Immunofluorescence co-localization: Use antibodies against SLC37A2 alongside markers for different organelles, including:

  • Endo-lysosomes: LAMP2, Rab7, Arl8

  • Early/recycling endosomes: Vps35

  • Endoplasmic reticulum: Protein disulfide isomerase (PDI)

  • Golgi: GM130

• Subcellular fractionation: Isolate different cellular compartments (e.g., enriched secretory lysosomes from osteoclasts) and analyze the presence of SLC37A2 by immunoblotting .

• High-resolution imaging techniques: Employ super-resolution microscopy or electron microscopy with immunogold labeling to precisely localize SLC37A2 within cellular compartments.

• Fluorescent protein tagging: Express SLC37A2 isoforms fused to different fluorescent proteins (e.g., emGFP-SLC37A2 isoform 2 and mCherry-SLC37A2 isoform 1) to compare their localization patterns. This approach has revealed that while both isoforms localize to tubular organelles, isoform 1 shows additional preference for the plasma membrane .

Why might SLC37A2 antibody staining show variability between experiments?

Several factors can contribute to variability in SLC37A2 antibody staining:

• Isoform specificity: SLC37A2 exists as multiple splice variants with different C-terminal regions and subcellular targeting signals . Antibodies that differentially recognize these isoforms may produce varying staining patterns.

• Post-translational modifications: SLC37A2 undergoes N-linked glycosylation, which can affect antibody binding . The degree of glycosylation may vary between cell types or experimental conditions.

• Fixation sensitivity: Different fixation methods can affect epitope accessibility. For immunohistochemistry, formalin/PFA-fixed paraffin-embedded sections have been successfully used , but optimization may be needed for different tissues.

• Expression levels: SLC37A2 expression varies significantly between cell types and can be regulated by differentiation or activation states. For example, its expression increases during monocyte-to-macrophage differentiation .

• Antibody lot variation: Different lots of the same antibody may show slight variations in specificity or sensitivity, particularly for polyclonal antibodies.

What controls should be included in SLC37A2 antibody experiments?

To ensure reliable results with SLC37A2 antibodies:

• Positive controls: Include samples known to express SLC37A2, such as:

  • HepG2 or HeLa cell lysates for Western blot

  • Macrophage cell lines or differentiated THP-1 cells

  • Osteoclasts for localization studies

• Negative controls: Where possible, include:

  • Tissues or cells from SLC37A2 knockout animals

  • Samples with siRNA-mediated knockdown of SLC37A2

  • Isotype control antibodies at the same concentration as the primary antibody

• Blocking peptide controls: Pre-incubate the antibody with the immunizing peptide before staining to verify specificity.

• Secondary antibody only controls: Omit the primary antibody to assess non-specific binding of the secondary antibody.

How can SLC37A2 protein levels be accurately quantified?

For accurate quantification of SLC37A2 protein levels:

• Western blot quantification: Use validated antibodies with appropriate loading controls (e.g., GAPDH ). Normalize SLC37A2 band intensity to loading controls using densitometry software such as ImageJ .

• Multiple antibodies approach: When possible, use multiple antibodies targeting different epitopes to confirm consistent quantification results.

• Standard curve: Include a standard curve using recombinant SLC37A2 protein of known concentration.

• Sample preparation considerations: Be consistent with sample preparation methods, as different lysis buffers or detergents may affect extraction efficiency of membrane proteins like SLC37A2.

• Multiple biological replicates: Due to potential variability, include at least three biological replicates and perform statistical analysis to determine significance of observed differences.

How can SLC37A2 function be assessed in relation to glucose metabolism?

To investigate the role of SLC37A2 in glucose metabolism:

• Transport assays: Measure glucose-6-phosphate transport across ER membranes in cells with modified SLC37A2 expression. Unlike SLC37A4, SLC37A2's antiport activity is independent of a lumenal glucose-6-phosphatase .

• Metabolic flux analysis: Employ isotope-labeled glucose to track metabolic pathways in cells with normal versus altered SLC37A2 expression.

• Phosphate homeostasis: Assess inorganic phosphate levels in cellular compartments, as SLC37A2 catalyzes both G6P:Pi and Pi:Pi exchanges .

• Glucose homeostasis measurements: Despite indications that SLC37A2 may not play a significant role in blood glucose regulation , comprehensive analysis of glucose metabolism parameters in SLC37A2 knockout models could reveal tissue-specific roles.

What approaches can be used to study the role of SLC37A2 in pathological conditions?

SLC37A2 may be involved in various pathological conditions including vascular calcification and bone disorders:

• Disease models: Investigate SLC37A2 expression in models such as adenine-induced chronic kidney disease rats, where SLC37A2 increases in smooth muscle cells, potentially contributing to vascular calcification .

• Bone pathology assessment: Study bone structure and resorption in SLC37A2 knockout mice using micro-CT, histomorphometry, and biochemical markers of bone turnover .

• Inflammatory conditions: Given its high expression in immune cells, examine SLC37A2 expression and function in models of inflammatory diseases using immunohistochemistry and functional assays.

• Therapeutic targeting: Develop approaches to modulate SLC37A2 activity as a potential therapeutic strategy for metabolic bone diseases .

How do the different SLC37A2 isoforms contribute to its cellular functions?

To dissect the roles of different SLC37A2 isoforms:

• Isoform-specific expression analysis: Use RT-PCR with primers specific to each splice variant to quantify their relative expression across tissues and cell types.

• Subcellular localization comparison: Express fluorescently tagged versions of each isoform to compare their localization patterns. Studies have shown that while both SLC37A2 isoforms localize to tubular organelles, isoform 1 shows additional preference for the plasma membrane, likely due to its alternative C-terminal targeting signal .

• Functional complementation: Perform rescue experiments in SLC37A2-deficient cells with constructs expressing individual isoforms to determine their functional redundancy or specificity.

• Protein interaction studies: Identify protein binding partners of each isoform using approaches like co-immunoprecipitation followed by mass spectrometry to elucidate isoform-specific protein complexes and signaling pathways.