ggact.2 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction

Gamma-Glutamylamine Cyclotransferase (GGACT) is an enzyme critical for proteolytic degradation, particularly in breaking down cross-linked fibrin into 5-oxo-L-proline and free alkylamines. The development of antibodies targeting GGACT has facilitated research into its biological roles, including fibrinolysis and protein degradation pathways. This article focuses on GGACT antibodies, their types, applications, and validation methods, drawing from peer-reviewed studies and commercial product data.

What is the GGACT Antibody?

The GGACT antibody is a polyclonal or monoclonal immunoglobulin designed to bind specifically to the GGACT protein. It is used in immunohistochemistry (IHC), Western blotting, and other immunoassays to study tissue expression, cellular localization, and enzymatic activity.

Key Features of GGACT Antibodies:

  • Target: Human GGACT protein (UniProt ID: Q9BVM4).

  • Immunogen Sequence: TLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCP .

  • Species Reactivity: Primarily human, with partial cross-reactivity to mouse (76%) and rat (78%) .

Polyclonal Antibodies

Polyclonal antibodies, such as HPA065320 (Sigma-Aldrich) and PA5-64214 (Thermo Fisher), are widely used for their broad epitope recognition.

HPA065320:

  • Source: Rabbit polyclonal.

  • Application: IHC (1:1000–2500 dilution).

  • Validation: Orthogonal RNAseq and protein array testing across 44 human tissues .

PA5-64214:

  • Source: Rabbit polyclonal.

  • Application: IHC, Western blot.

  • Specificity: Targets the enzyme’s role in fibrin degradation .

Immunohistochemistry (IHC)

  • Tissue Reactivity: High expression observed in liver, kidney, and lung tissues .

  • Disease Implications: Linked to conditions like propionic acidemia and cataract formation .

Enzymatic Activity Studies

  • GGACT antibodies are used to inhibit enzymatic activity in vitro, aiding mechanistic studies of cross-linked protein degradation .

Recombinant GGACT Proteins

  • ABIN7319224: A human recombinant GGACT protein (His-tagged) expressed in E. coli for antibody validation .

  • ABIN1635502: Zebrafish GGACT.2 protein (His-tagged) for cross-species studies .

Antibody Cross-Reactivity

  • Zebrafish GGACT.2: Antibodies targeting the human GGACT show partial cross-reactivity with zebrafish orthologs (e.g., ABIN1635502) .

Product Specs

Buffer
**Preservative:** 0.03% Proclin 300
**Constituents:** 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
ggact.2 antibody; zgc:92115Gamma-glutamylaminecyclotransferase B antibody; GGACT B antibody; EC 4.3.2.8 antibody; AIG2-like domain-containing protein 1-B antibody; Gamma-glutamylamine cyclotransferase B antibody; Gamma-glutamylamine cyclotransferase antibody; tandem duplicate 2 antibody
Target Names
ggact.2
Uniprot No.

Target Background

Function
This antibody may contribute to the degradation of proteins cross-linked by transglutaminases. It achieves this by degrading the cross-link between a lysine and a glutamic acid residue. Additionally, it catalyzes the formation of 5-oxo-L-proline from L-gamma-glutamyl-L-epsilon-lysine.
Database Links
Protein Families
Gamma-glutamylcyclotransferase family

Q&A

What is ggact.2 antibody and how does it function in research applications?

The ggact.2 antibody is a polyclonal antibody raised in rabbits that specifically targets the ggact.2 protein in Danio rerio (zebrafish). This target is a gamma-glutamylamine cyclotransferase that contributes to the degradation of proteins cross-linked by transglutaminases by catalyzing the formation of 5-oxo-L-proline from L-gamma-glutamyl-L-epsilon-lysine .

From a methodological perspective, this antibody is generated using recombinant Danio rerio ggact.2 protein as the immunogen and is purified through antigen affinity chromatography to ensure high specificity. The antibody's structure consists of unmodified IgG molecules in liquid form, stored in a buffer containing 0.03% Proclin 300 as a preservative, 50% Glycerol, and 0.01M PBS at pH 7.4 .

When implementing this antibody in experiments, researchers should note its validated applications include Western Blot (WB) and ELISA, with optimal dilutions typically determined through titration experiments (commonly starting at 1:500 for WB applications).

How does ggact.2 antibody differ from other GGACT antibodies in terms of specificity and applications?

The ggact.2 antibody specifically recognizes the zebrafish ggact.2 protein isoform, distinguishing it from:

  • Species-specific variants: Human and mouse GGACT antibodies target orthologous proteins with different epitope structures

  • Isoform-specific variants: Within zebrafish, ggact.1 and ggact.3 antibodies recognize different isoforms with distinct functional properties

This specificity has important methodological implications:

Antibody TypeTarget SpeciesPrimary ApplicationsCross-ReactivityMolecular Weight
ggact.2 (Zebrafish)Danio rerioWB, ELISALimited to zebrafish~17 kDa
Human GGACTHomo sapiensWB, IHC, IFHuman, may cross-react with primates17.3 kDa
Mouse GGACTMus musculusWB, IHCMouse, rat~17 kDa

When selecting between these antibodies, researchers must consider:

  • The specific model organism being studied

  • Required cross-reactivity profiles

  • The particular ggact isoform of interest in zebrafish studies

  • The experimental application, as validation status varies across different detection methods

What are the optimal storage and handling procedures for maintaining ggact.2 antibody activity?

To maintain optimal ggact.2 antibody functionality, implement these evidence-based methodological practices:

  • Long-term storage:

    • Store at -20°C or -80°C in the original buffer (0.03% Proclin 300, 50% Glycerol, 0.01M PBS, pH 7.4)

    • Avoid repeated freeze-thaw cycles, which significantly reduce antibody activity through protein denaturation

  • Working protocols:

    • Upon receipt, prepare small working aliquots (10-20 μL) to minimize freeze-thaw stress

    • For short-term use (1-2 weeks), store aliquots at 4°C

    • Document freeze-thaw cycles for each aliquot to maintain experimental reproducibility

  • Stability considerations:

    • Glycerol in the storage buffer (50%) functions as a cryoprotectant to prevent freeze damage

    • The antibody remains stable for approximately 12 months when stored properly

    • Visible precipitation indicates potential degradation; centrifuge briefly before use if this occurs

  • Quality control measures:

    • Periodically validate antibody performance using positive controls

    • Document lot numbers, as variation between manufacturing batches may occur

    • Include freshly thawed antibody controls when troubleshooting reduced performance

These protocols align with established best practices for polyclonal antibody maintenance and help ensure experimental reproducibility across studies .

What controls should be incorporated when using ggact.2 antibody in Western blot experiments?

A robust Western blot experimental design with ggact.2 antibody requires these methodological controls:

  • Primary validation controls:

    • Positive tissue control: Zebrafish tissue with confirmed ggact.2 expression

    • Negative tissue control: Tissue lacking ggact.2 expression or from knockdown/knockout models

    • Recombinant protein control: Purified ggact.2 protein to confirm antibody sensitivity

  • Technical controls:

    • Loading control: β-actin or GAPDH to confirm equal protein loading across samples

    • Molecular weight marker: To verify the ~17 kDa band expected for ggact.2

    • Dilution series: Serial dilutions of positive sample to establish detection limits

  • Antibody-specific controls:

    • Primary antibody omission: To assess secondary antibody specificity

    • Isotype control: Rabbit IgG at the same concentration to identify non-specific binding

    • Peptide competition: Pre-incubation with immunizing peptide to confirm specific binding

  • Sample preparation controls:

    • Multiple extraction methods: Compare RIPA, NP-40, and other lysis buffers

    • Denaturing vs. non-denaturing conditions: To assess epitope accessibility

    • Fresh vs. frozen sample preparation: To evaluate protein stability

Good experimental design requires systematic documentation of all variables, including incubation times, temperatures, blocking agents, and detection systems. This approach enables meaningful interpretation of results and facilitates troubleshooting of unexpected findings .

How should ggact.2 antibody concentration be optimized for different experimental applications?

Systematic optimization of ggact.2 antibody concentration is essential for generating reliable data. Implement these methodological approaches:

  • Western blot optimization:

    • Initial range finding: Test broad dilution range (1:100 to 1:5000)

    • Fine optimization: Narrow to 3-5 concentrations around promising results

    • Validation criteria: Signal-to-noise ratio, specificity (single band at ~17 kDa), and reproducibility

    • Documentation: Record absolute concentration (μg/mL) rather than just dilution factor

  • ELISA optimization:

    • Standard curve generation: Use recombinant ggact.2 protein

    • Antibody titration: Test dilutions from 1:100 to 1:10,000

    • Technical variables: Optimize coating buffer, blocking agent, and detection system

    • Analysis: Identify linear detection range and select concentration providing maximum signal without saturation

  • Application-specific considerations:

ApplicationStarting DilutionKey Optimization ParametersExpected Results
Western Blot1:500Secondary antibody ratio, blocking agentSingle band at ~17 kDa
ELISA1:1000Coating conditions, incubation timeLinear detection range
IHC/IF*1:100Fixation method, antigen retrievalSpecific cellular staining

*Note: While not explicitly validated for IHC/IF, these starting parameters can guide initial testing .

  • Optimization strategy:

    • Change one variable at a time

    • Include consistent positive and negative controls across all optimization experiments

    • Document all conditions systematically

    • Verify results across multiple experimental replicates

This structured approach enables identification of optimal antibody concentration while maintaining experimental rigor and reproducibility .

What blocking strategies are most effective when using ggact.2 antibody in immunoassays?

The choice of blocking agent significantly impacts ggact.2 antibody performance. Based on research with similar polyclonal antibodies, implement these methodological approaches:

  • Protein-based blocking agents:

    • Bovine Serum Albumin (BSA): Typically effective at 3-5% in PBS/TBS for zebrafish applications

    • Non-fat dry milk: Cost-effective at 5%, but may contain endogenous biotin that could interfere with detection systems

    • Fish gelatin: At 2-3% concentration provides excellent blocking for fish-derived samples with minimal cross-reactivity

  • Blocking optimization parameters:

Blocking AgentRecommended ConcentrationAdvantagesLimitationsBest Applications
BSA3-5%Low cross-reactivity, consistent qualityHigher costWestern blot, ELISA
Non-fat milk5%Economical, effective general blockerContains phosphoproteinsWestern blot
Fish gelatin2-3%Excellent for fish antibodiesLimited availabilityWestern blot, ELISA with zebrafish samples
Commercial blockersAs directedOptimized formulationsCost, proprietary compositionAll applications
  • Protocol optimization:

    • Blocking duration: 1 hour at room temperature or overnight at 4°C

    • Buffer composition: Add 0.1-0.3% Tween-20 to reduce hydrophobic background

    • Temperature effects: Higher temperatures can increase blocking efficiency but may reduce antibody specificity

    • Sequential blocking: Test dual blockers (e.g., 2% BSA followed by 2% normal goat serum)

  • Application-specific considerations:

    • For Western blot: Include blocking agent in antibody diluent at the same concentration

    • For ELISA: Consider different blockers for plate coating versus antibody incubation

    • For difficult samples: Increase blocking time or concentration before adjusting antibody parameters

These approaches should be systematically tested to identify optimal conditions for specific experimental paradigms with ggact.2 antibody .

How can specificity of ggact.2 antibody be validated in zebrafish tissues?

Validating ggact.2 antibody specificity requires multiple complementary approaches to establish confidence in experimental results:

  • Genetic validation methods:

    • Compare staining between wild-type and ggact.2 knockout/knockdown zebrafish

    • Use CRISPR-Cas9 generated models for complete gene deletion

    • Apply morpholino knockdown for temporary gene suppression

    • Expected outcome: Significant reduction or elimination of signal in genetic models

  • Molecular validation techniques:

    • Peptide competition assay: Pre-incubate antibody with excess immunizing peptide

    • Western blot analysis: Confirm single band at expected molecular weight (~17 kDa)

    • Mass spectrometry validation: Identify proteins in antibody-captured fraction

    • Recombinant protein panel: Test cross-reactivity with related proteins (ggact.1, ggact.3)

  • Expression pattern validation:

    • Compare antibody detection with established mRNA expression patterns

    • Correlate with in situ hybridization data using ggact.2-specific probes

    • Verify tissue distribution aligns with published expression databases

    • Assess developmental stage-specific expression patterns

  • Cross-reactivity assessment:

    • Test against known related proteins (ggact family members)

    • Evaluate across species (human, mouse GGACT) to confirm specificity

    • Assess performance in tissues with high vs. low known expression levels

    • Examine subcellular localization patterns for consistency with protein function

Systematic documentation of validation methods and results creates strong evidence for antibody specificity, which is essential for publication-quality research and experimental reproducibility .

How can ggact.2 antibody be optimized for immunoprecipitation experiments?

While ggact.2 antibody is not explicitly validated for immunoprecipitation (IP), polyclonal antibodies that perform well in Western blot often can be adapted for IP with methodological optimization:

  • Preliminary assessment protocol:

    • Test initial IP conditions with 2-5 μg antibody per 500 μg protein lysate

    • Include parallel IgG isotype control to assess non-specific binding

    • Analyze immunoprecipitated material by Western blot using the same antibody

    • Compare depleted supernatant with input to assess capture efficiency

  • Buffer optimization strategy:

Buffer TypeCompositionStrengthsLimitations
RIPA150mM NaCl, 1% NP-40, 0.5% sodium deoxycholate, 0.1% SDS, 50mM Tris pH 8.0Efficient extraction, reduces non-specific bindingMay disrupt some protein complexes
NP-40150mM NaCl, 1% NP-40, 50mM Tris pH 8.0Preserves protein-protein interactionsHigher background in some applications
Digitonin1% digitonin, 150mM NaCl, 50mM Tris pH 7.5Maintains membrane protein complexesLimited solubilization of some proteins
  • Technical optimization parameters:

    • Antibody immobilization: Direct coupling to beads using crosslinkers can reduce antibody contamination

    • Pre-clearing lysates: Incubation with beads alone reduces non-specific binding

    • Incubation conditions: Overnight at 4°C with gentle rotation enhances binding

    • Wash stringency gradient: Test increasing salt concentrations to optimize signal-to-noise ratio

  • Validation approaches:

    • Confirm captured protein identity by mass spectrometry

    • Detect co-immunoprecipitated proteins to identify interaction partners

    • Perform reverse IP with known interaction partners

    • Compare IP efficiency across different tissue/sample preparations

This methodological framework provides a systematic approach to developing IP protocols for ggact.2 antibody in zebrafish research applications .

What modifications are necessary to apply ggact.2 antibody in zebrafish developmental studies?

Adapting ggact.2 antibody protocols for developmental studies requires specific methodological considerations to account for embryonic tissue characteristics:

  • Developmental stage-specific fixation:

Developmental StageRecommended FixationPermeabilization MethodSpecial Considerations
Embryo (0-24 hpf)4% PFA, 2-4 hours, 4°C0.5% Triton X-100, 30 minChorion removal before or after fixation
Larva (24-72 hpf)4% PFA, 4-6 hours, 4°C0.5-1% Triton X-100, 1 hourPigment removal with H₂O₂ may be necessary
Juvenile (>72 hpf)4% PFA, overnight, 4°C1% Triton X-100, 2 hoursPotential requirement for decalcification
  • Whole-mount immunostaining optimization:

    • Extended blocking: Minimum 2 hours at room temperature or overnight at 4°C

    • Increased antibody concentration: Typically 2-3× higher than section staining

    • Extended incubation: Primary antibody for 48-72 hours at 4°C with gentle agitation

    • Enhanced washing: Minimum 6-8 hours with buffer changes every 30 minutes

  • Imaging considerations:

    • Tissue clearing techniques: CUBIC, CLARITY, or methyl salicylate for deep tissue imaging

    • Mounting media optimization: Glycerol-based media with anti-fade agents

    • Microscopy approaches: Confocal z-stacks or light sheet microscopy for 3D reconstruction

    • Image analysis: Deconvolution and background subtraction for optimal signal detection

  • Developmental controls:

    • Stage-matched wild-type controls processed identically

    • Developmental marker co-staining for precise staging

    • Temporal analysis across multiple developmental timepoints

    • Tissue-specific transgenic lines for cellular context

These methodological adaptations account for the unique challenges of zebrafish developmental biology while enabling specific detection of ggact.2 protein throughout embryogenesis .

What strategies enable successful multi-color immunofluorescence with ggact.2 antibody?

Implementing multi-color immunofluorescence with ggact.2 antibody requires careful methodological planning to ensure specificity and minimize cross-reactivity:

  • Antibody compatibility assessment:

    • The rabbit-derived ggact.2 antibody can be paired with mouse, chicken, or goat primary antibodies

    • Select secondary antibodies raised in species that don't cross-react with zebrafish tissues

    • Perform single-color controls alongside multi-color experiments

    • Consider direct conjugation for challenging multiple rabbit antibody applications

  • Sequential vs. simultaneous staining protocols:

Protocol ApproachMethodologyAdvantagesLimitations
SequentialApply first primary, wash, first secondary, wash, second primary, etc.Minimal cross-reactivity, higher specificityTime-consuming, potential epitope blocking
SimultaneousMix compatible primaries, apply together, wash, apply mixed secondariesFaster, less tissue manipulationPotential cross-reactivity, requires extensive validation
MixedSimultaneous primaries, sequential secondariesBalance of efficiency and specificityIntermediate complexity
  • Fluorophore selection strategy:

    • Choose fluorophores with minimal spectral overlap:

      • Rabbit anti-ggact.2 + Alexa Fluor 488 (green)

      • Mouse antibody + Alexa Fluor 594 (red)

      • Chicken antibody + Alexa Fluor 647 (far-red)

    • Include single-color controls for spectral bleed-through assessment

    • Consider lower-expressing markers with brighter fluorophores

  • Technical optimization parameters:

    • Implement spectral unmixing for overlapping emissions

    • Use sequential scanning on confocal microscopes

    • Apply image restoration techniques (deconvolution)

    • Employ quantitative colocalization analysis (Pearson's coefficient, Manders' overlap)

This methodological framework enables complex multi-parameter analysis of ggact.2 expression in relation to other proteins of interest in zebrafish research applications .

How can ggact.2 antibody be applied to analyze protein expression across different zebrafish tissues?

Analyzing tissue-specific ggact.2 expression patterns requires methodological approaches that address tissue heterogeneity while maintaining detection sensitivity:

  • Tissue-specific sample preparation:

Tissue TypePreparation MethodFixation ProtocolSpecial Considerations
BrainDissection before fixation4% PFA, 24h, 4°CCareful handling to preserve morphology
MuscleFlash freezing or immediate fixation2% PFA, 2h, 4°CExtend permeabilization for dense tissue
KidneyMicro-dissection4% PFA, 4h, 4°CPrimary site of ggact.2 expression
Embryonic tissuesWhole-mount processing2% PFA, 2h, 4°CStage-specific fixation optimization
  • Quantitative analysis approaches:

    • Western blot quantification:

      • Normalization to tissue-specific housekeeping proteins

      • Standard curve with recombinant protein for absolute quantification

      • Tissue-specific extraction buffer optimization

    • Immunofluorescence quantification:

      • Mean fluorescence intensity measurements

      • Cell counting for percentage expression analysis

      • 3D volumetric quantification for spatial distribution

  • Comparative expression analysis:

    • Cross-tissue normalization strategies:

      • Total protein normalization (Ponceau, REVERT)

      • Multiple reference gene approach

      • Tissue-specific internal controls

    • Developmental timeline assessment:

      • Age-matched samples across tissues

      • Standardized developmental staging

      • Correlation with known developmental markers

  • Validation across methods:

    • Correlation with mRNA expression (qRT-PCR, in situ hybridization)

    • Protein mass spectrometry validation

    • Single-cell analysis for cellular heterogeneity

    • Tissue-specific knockout/knockdown controls

This comprehensive methodological framework enables reliable quantitative assessment of ggact.2 expression patterns across diverse zebrafish tissues throughout development .

How can high background signal be reduced when using ggact.2 antibody in immunostaining applications?

High background is a common challenge with antibody-based detection. Implement these methodological solutions specifically optimized for ggact.2 antibody in zebrafish applications:

  • Blocking optimization strategy:

    • Extended blocking: Increase from standard 1 hour to 3+ hours or overnight

    • Alternative blocking agents: Test fish gelatin (3%), casein (0.5%), or commercial blockers

    • Dual blocking: Sequential application of different blockers (e.g., normal serum followed by BSA)

    • Additives: Include 0.1-0.3% Triton X-100 plus 0.1% Tween-20 to reduce hydrophobic interactions

  • Antibody dilution and incubation optimization:

FactorStandard ConditionOptimization ApproachExpected Outcome
Primary antibody dilution1:500Test 1:1000-1:5000 rangeReduced non-specific binding
Incubation temperatureRoom temperature4°C with extended timeIncreased specificity
Wash duration3 × 5 minutes6 × 10 minutesRemoval of unbound antibody
Diluent compositionPBS + 1% BSAPBS + 0.5% BSA + 0.1% gelatinReduced non-specific binding
  • Tissue-specific treatment approaches:

    • Zebrafish autofluorescence reduction:

      • Sudan Black B treatment (0.1-0.3% in 70% ethanol for 10 minutes)

      • Copper sulfate quenching (50mM CuSO₄ in 50mM ammonium acetate, pH 5.0)

      • Photobleaching (1-2 hours UV exposure before antibody application)

    • Pigment removal: 0.1-0.3% H₂O₂ treatment for pigmented tissues

  • Detection system modifications:

    • Secondary antibody optimization:

      • High cross-adsorption secondary antibodies

      • Further dilution (1:1000 to 1:5000)

      • Fragment antibodies (Fab) to reduce non-specific binding

    • Signal-to-noise enhancement:

      • Tyramide signal amplification for weak signals

      • Confocal microscopy with narrow bandpass filters

      • Post-acquisition image processing (deconvolution, background subtraction)

These methodological approaches should be tested systematically, changing one variable at a time, to identify the specific factors contributing to background in each experimental context .

What fixation protocols are optimal for ggact.2 antibody detection in different sample types?

Fixation significantly impacts epitope preservation and accessibility. For ggact.2 antibody, implement these methodologically optimized protocols:

  • Paraformaldehyde (PFA) fixation optimization:

Sample TypePFA ConcentrationDurationTemperaturePost-fixation Processing
Adult tissues4% in PBS, pH 7.424 hours4°CPBS washing (3×15 min), sucrose cryoprotection
Larvae (3-7 dpf)2-4% in PBS2-4 hours4°CPBS washing (6×10 min)
Early embryos2% in PBS1-2 hours4°CPBS washing (6×5 min)
Cell cultures2% in PBS10-15 minutesRoom tempPBS washing (3×5 min)
  • Alternative fixation approaches:

    • Methanol fixation:

      • 100% methanol at -20°C for 10-20 minutes

      • Particularly effective for cytoskeletal and nuclear proteins

      • May preserve different epitopes than PFA

    • Hybrid protocols:

      • Brief PFA (10 minutes) followed by methanol (-20°C)

      • Combines cross-linking and precipitating mechanisms

      • Test compatibility with ggact.2 epitope preservation

  • Technical optimization parameters:

    • Fresh vs. aged fixative: Use freshly prepared PFA for optimal results

    • Fixative pH: Maintain at physiological pH (7.2-7.4) for protein structure preservation

    • Perfusion vs. immersion: For adult fish, consider perfusion fixation

    • Pre-fixation handling: Minimize time between sample collection and fixation

  • Tissue-specific considerations:

    • Muscle tissue: Brief fixation (1-2 hours) to prevent over-fixation and epitope masking

    • Brain tissue: Longer fixation (24 hours) for structural preservation

    • Embryos: Chorion removal before or after fixation affects penetration

    • Calcified tissues: Decalcification step (0.5M EDTA) after fixation

These methodologically optimized fixation protocols maintain the balance between tissue morphology preservation and epitope accessibility for ggact.2 antibody detection .

What epitope retrieval methods enhance ggact.2 antibody detection in fixed zebrafish tissues?

Epitope retrieval can significantly enhance detection sensitivity for ggact.2 antibody by unmasking epitopes modified during fixation. Implement these methodological approaches:

  • Heat-induced epitope retrieval (HIER) protocols:

Buffer CompositionpHTemperatureDurationBest Applications
10mM Sodium Citrate6.095-100°C10-20 minStandard approach for most tissues
10mM Tris, 1mM EDTA9.095-100°C10-20 minMay expose different epitopes than citrate
10mM Glycine3.595°C5-10 minAlternative for over-fixed samples
  • Enzymatic epitope retrieval approaches:

    • Proteinase K digestion:

      • 10-20 μg/mL in PBS at 37°C for 5-15 minutes

      • Carefully titrate time to prevent over-digestion

      • Particularly useful for heavily fixed tissues

    • Trypsin treatment:

      • 0.025-0.1% in PBS at 37°C for 5-10 minutes

      • Gentler than Proteinase K

      • Monitor closely to prevent tissue damage

  • Application-specific protocol selection:

Sample TypeRecommended ApproachTechnical Considerations
Paraffin sectionsHIER with citrate bufferComplete deparaffinization critical
CryosectionsMild HIER or no retrievalBrief fixation typically sufficient
Whole-mount embryosBrief Proteinase K treatmentTime dependent on developmental stage
Adult tissuesHIER with extended coolingTissue thickness affects penetration
  • Optimization strategy:

    • Test multiple retrieval methods on serial sections

    • Include no-retrieval control

    • Evaluate signal intensity, background levels, and tissue morphology

    • Document optimal conditions for each tissue and developmental stage

These methodologically optimized epitope retrieval approaches can significantly enhance ggact.2 detection while maintaining tissue integrity and minimizing background signal .

What quantification approaches provide reliable data analysis for ggact.2 antibody experiments?

Reliable quantification of ggact.2 antibody signals requires rigorous methodological approaches to ensure reproducibility and statistical validity:

  • Western blot quantification methodology:

    • Sample preparation standardization:

      • Equal protein loading confirmed by total protein staining

      • Consistent lysis and denaturation conditions

      • Include standard curve with recombinant ggact.2 protein

    • Analysis approach:

      • Measure integrated density rather than peak intensity

      • Normalize to appropriate loading controls

      • Verify signal is within linear detection range

      • Apply statistical analysis appropriate for sample distribution

  • Immunofluorescence quantification strategies:

  • Statistical considerations:

    • Sample size determination:

      • Power analysis based on expected effect size

      • Minimum n=3 biological replicates

      • Technical replicates within each biological sample

    • Appropriate statistical tests:

      • Two-group comparisons: t-test or Mann-Whitney based on normality

      • Multi-group: ANOVA with appropriate post-hoc tests

      • Paired samples: Paired t-test or Wilcoxon signed-rank test

  • Reproducibility and validation approaches:

    • Orthogonal validation with complementary techniques

    • Blind analysis to prevent observer bias

    • Standardized protocols with detailed methodology documentation

    • Data sharing with raw images and analysis parameters

Implementing these methodologically rigorous quantification approaches ensures reliable and reproducible data analysis in ggact.2 antibody experiments across different researchers and laboratories .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.