glod5 Antibody

What is GLOD5 and where is it typically expressed?

GLOD5 (Glyoxalase Domain Containing 5) is a protein containing a glyoxalase domain that belongs to the glyoxalase I family . It is one of six structurally and functionally diverse enzymes in the glyoxalase gene family with broad roles in metabolism . Based on data from the Human Protein Atlas project, GLOD5 shows tissue-specific expression patterns that researchers should consider when designing experiments .

Methodology note: When investigating GLOD5 expression, researchers should consult up-to-date databases such as the Human Protein Atlas to understand baseline expression levels across different tissues and cell lines before experimental design.

What types of GLOD5 antibodies are available for research applications?

Several types of GLOD5 antibodies are available for research purposes:

Methodologically, polyclonal antibodies offer advantages for detection of low-abundance targets due to their recognition of multiple epitopes, while targeted antibodies against specific amino acid regions can provide greater specificity for particular domains of the protein .

What applications are GLOD5 antibodies validated for?

GLOD5 antibodies have been validated for multiple applications with varying protocol specifications:

• Immunohistochemistry (IHC): Typically at dilutions of 1:50-1:200 or 1:500-1:1000

• Western blot (WB): Recommended at 0.04-0.4 μg/mL

• Immunofluorescence (IF): Optimal at 0.25-2 μg/mL

• ELISA: Validated with recombinant GLOD5 proteins

For experimental design, researchers should select antibodies validated specifically for their application of interest, as performance can vary significantly between applications .

How should I select the most appropriate GLOD5 antibody for my specific experimental needs?

Selection of a GLOD5 antibody should follow a systematic approach based on:

• Target specificity: Review the immunogen sequence to ensure it matches your research focus. For example, the antibody HPA010667 targets the sequence "RRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDRKALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNY" , while others target specific regions like aa 24-145 .

• Cross-reactivity: Examine species homology - some GLOD5 antibodies show cross-reactivity with mouse (86% sequence identity) and rat (87% sequence identity) orthologs .

• Application compatibility: Select antibodies specifically validated for your technique. Many GLOD5 antibodies are validated for multiple applications, but performance may vary by application .

• Validation data: Review published validation data through resources like Antibodypedia or the Human Protein Atlas linked to products like HPA010667 .

Methodologically, preliminary testing with positive and negative controls is essential regardless of supplier validation data to confirm performance in your specific experimental system.

What are the optimal protocols for using GLOD5 antibodies in immunohistochemistry?

For optimal immunohistochemistry results with GLOD5 antibodies:

• Sample preparation: Formalin-fixed, paraffin-embedded tissues are typically used with GLOD5 antibodies like HPA010667 .

• Antigen retrieval: Heat-induced epitope retrieval in citrate buffer (pH 6.0) or EDTA buffer (pH 9.0) is recommended based on Prestige Antibodies protocols .

• Antibody dilution: For HPA010667, use 1:50-1:200 dilution ; for other antibodies like those from Human Protein Atlas, dilutions of 1:500-1:1000 may be appropriate .

• Detection system: Most published protocols use biotin-streptavidin or polymer-based detection systems with DAB as the chromogen .

• Controls: Include both positive tissue controls (based on Human Protein Atlas data) and negative controls (primary antibody omission) .

The methodological approach should include optimization of antibody concentration through dilution series testing and careful selection of appropriate positive control tissues based on known expression patterns.

What considerations should be made for Western blot applications with GLOD5 antibodies?

When performing Western blots with GLOD5 antibodies:

• Sample preparation: Optimal lysis buffers typically contain non-ionic detergents (e.g., 1% Triton X-100) with protease inhibitors to preserve protein integrity.

• Protein loading: 20-50 μg of total protein is typically sufficient for detection of endogenous GLOD5.

• Expected molecular weight: The predicted molecular weight of human GLOD5 is approximately 16-17 kDa, but post-translational modifications may alter migration patterns .

• Blocking conditions: 5% non-fat dry milk or BSA in TBST is typically effective for reducing background.

• Antibody concentration: For optimal results, use antibody at 0.04-0.4 μg/mL for WB applications .

• Detection systems: Both chemiluminescent and fluorescent secondary detection systems have been successfully used with GLOD5 antibodies.

Methodologically, inclusion of appropriate positive control lysates and verification with recombinant GLOD5 protein (such as the one described in result ) can help validate specificity.

How can GLOD5 antibodies be applied in studying the glyoxalase pathway and metabolic disorders?

GLOD5 belongs to the glyoxalase gene family, which plays important roles in metabolism . While specific functions of GLOD5 are not well characterized, researchers can apply these methodological approaches:

• Comparative expression studies: Use GLOD5 antibodies alongside antibodies against other glyoxalase family members (e.g., GLOD4, which has a HPA023246 antibody available ) to investigate relative expression patterns in metabolic disorders.

• Co-localization studies: Combine GLOD5 antibodies with markers of specific cellular compartments to determine subcellular localization, which may provide functional insights.

• Expression correlation analysis: Correlate GLOD5 expression with metabolic intermediates or clinical parameters in patient samples to identify potential associations with disease phenotypes.

• Knockdown/overexpression validation: Use GLOD5 antibodies to validate knockdown or overexpression models when investigating functional roles of this protein.

Research on related family members like GLO1 has shown associations with diabetic complications and anxiety-like behaviors , suggesting potential research directions for GLOD5 investigation.

What strategies should be employed to validate GLOD5 antibody specificity for critical research applications?

Rigorous validation of GLOD5 antibodies should include:

• Immunogen competition assays: Pre-incubate the antibody with excess immunizing peptide (like the sequences described in results and ) to demonstrate signal abolishment.

• Genetic models: Test antibody reactivity in GLOD5 knockout/knockdown models compared to wildtype controls. Signal absence in knockout models strongly supports specificity.

• Orthogonal detection methods: Compare antibody-based detection with mRNA expression data or mass spectrometry protein identification.

• Cross-reactivity testing: Evaluate potential cross-reactivity with other glyoxalase family members (GLOD1-4) using recombinant proteins.

• Multiple antibody concordance: Compare results using different antibodies targeting distinct epitopes of GLOD5 (e.g., comparing results from antibodies targeting aa 24-145 versus those using the full immunogen sequence ).

Methodologically, researchers should document all validation steps performed and include appropriate controls in publications to enhance reproducibility.

How do post-translational modifications affect GLOD5 antibody recognition and experimental interpretation?

Post-translational modifications (PTMs) can significantly impact antibody recognition of GLOD5. Consider these methodological approaches:

• Epitope mapping: Determine if the antibody's epitope contains potential PTM sites by analyzing the immunogen sequence. For example, the sequence "RRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDRKALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNY" should be analyzed for potential phosphorylation, glycosylation, or other modification sites.

• Modification-specific detection: Use phosphatase or glycosidase treatments of samples prior to antibody application to determine if modifications affect detection.

• Multiple antibody comparison: Compare results using antibodies targeting different regions of GLOD5 to identify discrepancies that might indicate PTM interference.

• Mass spectrometry correlation: Validate antibody findings with mass spectrometry approaches that can identify both the protein and its modifications.

Note that most commercial GLOD5 antibodies are raised against unmodified recombinant proteins or peptides , potentially limiting their ability to recognize modified forms of the protein in biological samples.

What are common problems encountered with GLOD5 antibodies and how can they be addressed?

Common technical challenges with GLOD5 antibodies include:

When troubleshooting GLOD5 antibody applications, a systematic approach altering one variable at a time is recommended, with appropriate positive and negative controls for each experiment .

How should researchers interpret conflicting results obtained with different GLOD5 antibodies?

When confronted with discrepant results using different GLOD5 antibodies:

• Compare epitope regions: Analyze whether antibodies target different domains of GLOD5. The full protein sequence versus targeted regions (like aa 24-145 ) may yield different results.

• Evaluate validation rigor: Assess the validation evidence for each antibody. Those validated through the Human Protein Atlas project undergo extensive testing .

• Consider technical variables: Different application protocols may affect antibody performance (fixation methods for IHC, lysis conditions for WB).

• Investigate biological explanations: Different antibodies may recognize distinct isoforms, splice variants, or post-translationally modified versions of GLOD5.

• Perform orthogonal validation: Use non-antibody methods (mRNA analysis, mass spectrometry) to determine which antibody results align with other detection methods.

Methodologically, researchers should report discrepancies transparently in publications and provide details about the specific antibodies and protocols used to enhance reproducibility.

What approaches can be used to optimize signal-to-noise ratio when working with low abundance of GLOD5 in samples?

For detecting low-abundance GLOD5:

• Signal amplification systems:

  • For IHC/ICC: Use tyramide signal amplification or polymer-based detection systems

  • For WB: Consider enhanced chemiluminescence substrates or fluorescent secondary antibodies with digital acquisition

• Sample enrichment techniques:

  • Immunoprecipitation to concentrate GLOD5 before detection

  • Subcellular fractionation to isolate compartments with higher GLOD5 concentration

  • Phosphatase/protease inhibitor cocktails to preserve protein integrity

• Antibody optimization:

  • Extended primary antibody incubation (overnight at 4°C)

  • Optimized antibody concentration through careful titration

  • Use of antibodies targeting the most abundant epitopes

• Protocol modifications:

  • Extended exposure times for imaging (balanced against background increase)

  • Modified blocking solutions to reduce background while preserving specific signals

  • Antigen retrieval optimization for maximum epitope exposure

Methodologically, maintaining a consistent protocol once optimized is critical for reproducible detection of low-abundance targets .

How can GLOD5 antibodies be applied in multiplex immunofluorescence studies?

For multiplex immunofluorescence applications with GLOD5 antibodies:

• Compatible antibody selection: Choose GLOD5 antibodies raised in different host species than other target antibodies to avoid cross-reactivity.

• Sequential staining approaches:

  • Tyramide signal amplification allows sequential use of antibodies from the same species

  • Strip-and-reprobe methods can be used with appropriate controls for incomplete stripping

• Spectral considerations:

  • Select fluorophore combinations with minimal spectral overlap

  • Include single-stain controls for spectral unmixing algorithms

• Validation strategies:

  • Perform parallel single-stain experiments to confirm multiplex results

  • Include appropriate blocking steps between sequential antibody applications

• Analysis methods:

  • Implement colocalization analysis for spatial relationships between GLOD5 and other proteins

  • Use image segmentation algorithms to quantify cell-specific expression

While no specific multiplex protocols with GLOD5 were described in the search results, standard immunofluorescence protocols for GLOD5 antibodies can be adapted using these methodological principles .

What considerations should be made when using GLOD5 antibodies in single-cell protein analysis techniques?

For single-cell analysis with GLOD5 antibodies:

• Flow cytometry applications:

  • Optimize fixation/permeabilization for intracellular GLOD5 detection

  • Validate antibody performance in flow cytometry specifically, as performance may differ from IHC/WB

  • Use appropriate compensation controls when multiplexing with other markers

• Mass cytometry (CyTOF) applications:

  • Metal-conjugated GLOD5 antibodies must be validated specifically for CyTOF applications

  • Titrate antibodies to determine optimal concentration for specific vs. background signal

  • Include appropriate isotype controls

• Single-cell imaging applications:

  • Optimize signal amplification for detection of low-abundance GLOD5

  • Implement automated segmentation algorithms for quantitative analysis

  • Consider photobleaching properties of fluorophores for live-cell imaging

• Normalization approaches:

  • Include housekeeping protein controls appropriate for normalization

  • Consider cell cycle effects on GLOD5 expression in interpretation

Although the search results don't specifically address GLOD5 in single-cell analyses, these methodological approaches can be adapted from general antibody protocols for these applications .

How might GLOD5 antibodies contribute to understanding the role of glyoxalase enzymes in neurodegenerative diseases?

Glyoxalase enzymes have been implicated in neurodegenerative processes through their role in detoxifying reactive carbonyls and preventing advanced glycation end-product formation. For investigating GLOD5 in this context:

• Comparative expression analysis:

  • Use GLOD5 antibodies alongside other glyoxalase family members in neurodegenerative disease models

  • Perform quantitative IHC/IF in patient samples compared to controls

  • Correlate expression with disease severity metrics

• Mechanistic investigations:

  • Examine colocalization with protein aggregates characteristic of neurodegenerative diseases

  • Assess GLOD5 levels in response to oxidative stress challenges

  • Investigate potential neuroprotective functions through knockdown/overexpression

• Translational applications:

  • Screen compounds for effects on GLOD5 expression using validated antibodies

  • Monitor GLOD5 as a potential biomarker in treatment response studies

  • Develop tissue-based diagnostics using optimized IHC protocols

While direct evidence linking GLOD5 to neurodegeneration wasn't present in the search results, related glyoxalase family members have been connected to neurological phenotypes, such as the association between GLO1 and anxiety-like behavior , suggesting potential research directions.