GON7 antibodies are immunoreagents designed to detect and quantify the GON7 protein (UniProt ID: Q9BXV9), a 100-amino acid intrinsically disordered protein that becomes structured upon binding to the LAGE3 subunit within the KEOPS complex . These antibodies enable researchers to investigate GON7's role in tRNA modification, cell proliferation, and disease pathogenesis, particularly in GAMOS and related disorders.
Cellular Proliferation Studies: Knockdown of GON7 in human podocytes reduces cell proliferation, as demonstrated using RNA interference and antibody-based protein detection .
t6A Biosynthesis Assays: GON7 antibodies have been employed to confirm the absence of GON7 protein in fibroblasts from GAMOS patients with GON7 nonsense mutations (e.g., p.Tyr7*), correlating with reduced t6A levels .
The Aviva Systems Biology antibody (ARP69018_P050) targets a synthetic peptide from the C-terminal region (residues 79–100: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS), which shares 86% homology with cow and dog orthologs .
Western Blot: Detects endogenous GON7 at ~11 kDa in human cell lysates .
Immunohistochemistry: Atlas Antibodies’ HPA051832 shows nuclear and cytoplasmic staining in human kidney tissue .
GON7 antibodies have been instrumental in diagnosing and characterizing GAMOS. For example:
Founder Mutation Detection: A homozygous GON7 mutation (c.21C>A, p.Tyr7*) was identified in multiple Algerian families using antibody-based protein analysis, confirming the absence of GON7 expression .
Functional Rescue Experiments: Complementation assays in yeast Δgon7 strains demonstrated that human GON7 mutants fail to restore t6A biosynthesis, underscoring the necessity of functional GON7 .
While existing antibodies are critical for basic research, their utility in clinical diagnostics remains limited due to:
Specificity Issues: Cross-reactivity with disordered protein regions requires rigorous validation.
Quantitative Limitations: Current antibodies lack standardized protocols for absolute quantification in patient samples.
Future studies should focus on developing monoclonal antibodies with higher specificity and integrating GON7 detection into multi-omics platforms for precision medicine applications.
KEGG: ago:AGOS_AEL144W
STRING: 33169.AAS52541
GON7 (also known as C14orf142) is a protein of interest in human cellular biology. It functions as a component of the KEOPS complex involved in tRNA modification. Understanding GON7's expression patterns and interactions requires specific antibodies validated for research applications. The antibody against human GON7 enables researchers to study its expression patterns, cellular localization, and potential roles in various biological processes . Research using GON7 antibodies typically employs techniques such as immunohistochemistry (IHC), immunocytochemistry-immunofluorescence (ICC-IF), and Western blotting (WB) to investigate this protein's functions.
Rigorous validation is essential for ensuring antibody specificity. For GON7 antibodies, the gold standard validation approach involves using knockout cell lines as negative controls. This methodology, as demonstrated in large-scale antibody validation studies, allows researchers to confidently determine whether bands detected in Western blots represent authentic GON7 protein or non-specific binding .
The following table outlines the recommended validation approaches for GON7 antibodies:
| Validation Method | Implementation | Advantages | Limitations |
|---|---|---|---|
| Knockout validation | Testing antibody on GON7 knockout vs. wild-type cells | Definitive specificity confirmation | Requires development of knockout lines |
| Knockdown validation | siRNA or shRNA against GON7 mRNA | Less resource-intensive than knockout | Incomplete knockdown can complicate interpretation |
| Peptide blocking | Pre-incubation with immunizing peptide | Simple to implement | Limited specificity confirmation |
| Multiple antibody concordance | Compare results from different GON7 antibodies | Strengthens confidence in observations | Requires multiple validated antibodies |
Commercially available GON7 antibodies undergo validation for specific applications. The rabbit polyclonal GON7 antibody from Atlas Antibodies, for example, is validated for immunohistochemistry (IHC), immunocytochemistry-immunofluorescence (ICC-IF), and Western blot (WB) applications . During experimental design, researchers should confirm that their selected antibody has been specifically validated for their intended application.
GON7 antibodies are typically available at concentrations such as 0.1 mg/ml , but the optimal working dilution varies by application. The table below provides general guidelines for GON7 antibody applications:
| Application | Typical Dilution Range | Starting Dilution Recommendation | Optimization Strategy |
|---|---|---|---|
| Western Blot | 1:500 - 1:5000 | 1:1000 | Serial dilutions to optimize signal-to-noise ratio |
| IHC/ICC-IF | 1:50 - 1:500 | 1:100 | Titration experiments with both positive and negative controls |
| Flow Cytometry | 1:50 - 1:200 | 1:100 | Fluorescence-minus-one controls for accurate gating |
| IP/Co-IP | 1:50 - 1:200 | 1:100 | Pre-clearing lysates to reduce non-specific binding |
Knockout validation represents a critical approach for confirming antibody specificity. Large-scale antibody validation studies have demonstrated that comparing antibody performance between parental and knockout cell lines provides definitive evidence of specificity . For GON7 antibody experiments, implementing this validation approach involves:
Developing GON7 knockout cell lines using CRISPR-Cas9 or similar gene editing technologies
Running parallel experiments with wild-type and knockout cells
Analyzing band patterns in Western blots to identify true GON7 signals versus non-specific binding
Documenting this validation comprehensively in research publications
In studies where developing knockout lines is infeasible, alternative approaches include using published knockout validation data, siRNA knockdown validation, or comparing results across multiple antibodies targeting different GON7 epitopes.
When different GON7 antibodies yield inconsistent results, a systematic troubleshooting approach is essential. Contradictory results often stem from differences in epitope recognition, specificity, or technical factors. Researchers should:
Compare the epitopes recognized by each antibody (N-terminal, C-terminal, or internal domains)
Assess validation documentation for each antibody, prioritizing those with knockout validation
Evaluate whether post-translational modifications might affect epitope recognition
Consider whether splice variants of GON7 might explain differential recognition patterns
Implement side-by-side testing under identical conditions with appropriate positive and negative controls
Standardized validation approaches similar to those used in comprehensive antibody assessment studies can help resolve such contradictions by systematically evaluating each antibody's specificity and sensitivity .
Fixation methods significantly impact antibody performance in immunohistochemistry and immunocytochemistry. For GON7 antibodies, researchers should consider:
| Fixation Method | Impact on GON7 Detection | Recommended Protocol | Considerations |
|---|---|---|---|
| Paraformaldehyde (4%) | Preserves morphology with moderate epitope masking | 15-20 minutes at room temperature | May require antigen retrieval |
| Methanol | Exposes some epitopes while masking others | 10 minutes at -20°C | Compromises membrane structures |
| Acetone | Rapid fixation with less cross-linking | 5-10 minutes at -20°C | May not preserve fine structural details |
| Glutaraldehyde | Strong fixation for electron microscopy | 0.1-2.5% in buffer | Often causes high autofluorescence |
| Combined PFA/methanol | Balances preservation and accessibility | Sequential application | May provide optimal results for some epitopes |
Optimization experiments comparing these fixation methods are recommended when establishing new GON7 immunostaining protocols.
For optimal Western blot results with GON7 antibodies, the following protocol is recommended:
Sample preparation:
Lyse cells in RIPA buffer supplemented with protease inhibitors
Quantify protein concentration (BCA or Bradford assay)
Prepare samples (20-40 μg total protein) in reducing Laemmli buffer
Heat samples at 95°C for 5 minutes
Gel electrophoresis and transfer:
Separate proteins on 10-12% SDS-PAGE gels
Transfer to PVDF membranes (nitrocellulose is a suitable alternative)
Verify transfer efficiency with Ponceau S staining
Immunodetection:
Block membranes with 5% non-fat milk or BSA in TBST for 1 hour at room temperature
Incubate with GON7 antibody (typically 1:1000 dilution) overnight at 4°C
Wash 3× with TBST, 5 minutes each
Incubate with HRP-conjugated secondary antibody (1:5000) for 1 hour at room temperature
Wash 3× with TBST, 5 minutes each
Develop using ECL substrate and appropriate imaging system
Controls:
Immunoprecipitation (IP) with GON7 antibodies allows for the isolation of GON7 and its interaction partners. For optimal results:
Pre-clearing lysate:
Incubate cell lysate with protein A/G beads for 1 hour at 4°C
Remove beads by centrifugation to reduce non-specific binding
Antibody binding:
Add 2-5 μg of GON7 antibody to 500 μg of pre-cleared lysate
Incubate overnight at 4°C with gentle rotation
Immunocapture:
Add 30-50 μl of protein A/G beads
Incubate for 2-4 hours at 4°C with gentle rotation
Wash beads 4-5 times with cold lysis buffer
Elution and analysis:
Controls:
Include an isotype control antibody IP
Analyze input, unbound, and IP fractions
Consider using knockout cells as negative controls
Proper controls are essential for generating reliable data with GON7 antibodies. Based on standardized antibody validation approaches, researchers should implement the following controls :
| Control Type | Purpose | Implementation |
|---|---|---|
| Positive control | Confirms ability to detect GON7 | Use cell lines/tissues with known GON7 expression |
| Negative control | Assesses non-specific binding | Use GON7 knockout cells or tissues |
| Technical controls | Evaluate procedure integrity | Primary antibody omission, isotype controls |
| Loading controls | Ensure equal sample loading | Housekeeping proteins (GAPDH, β-actin) |
| Knockdown validation | Confirms signal specificity | siRNA targeting GON7 to reduce signal |
| Peptide competition | Verifies epitope specificity | Pre-incubate antibody with immunizing peptide |
Accurate quantification of GON7 expression requires appropriate normalization and statistical analysis. Recommended approaches include:
For Western blot quantification:
Use densitometry to measure band intensity
Normalize GON7 signal to loading controls (GAPDH, β-actin, total protein)
Include biological replicates (n≥3) for statistical analysis
Report data as fold change relative to control conditions
For immunofluorescence quantification:
Measure average fluorescence intensity within defined cellular regions
Normalize to cell area or nuclear staining
Analyze sufficient cell numbers (typically >30 cells per condition)
Use appropriate statistical tests (t-test, ANOVA) based on data distribution
For flow cytometry:
Report median fluorescence intensity rather than mean
Use fluorescence-minus-one controls for gating
Normalize to unstained or isotype controls
For immunohistochemistry:
Use standardized scoring systems (H-score, Allred score)
Blind scorers to experimental conditions
Implement positive and negative tissue controls
Determining optimal antibody concentration requires systematic titration experiments. For GON7 antibodies, which are typically supplied at concentrations around 0.1 mg/ml , consider:
Titration strategy:
Start with manufacturer's recommended dilution
Test 3-5 dilutions spanning 2-3 orders of magnitude
Include positive and negative controls at each dilution
Evaluation criteria:
Signal-to-noise ratio (specific vs. non-specific signal)
Consistency across replicate samples
Minimal background in negative controls
Application-specific considerations:
Western blot: 1:500-1:5000 dilution range
IHC/ICC: 1:50-1:500 dilution range
Flow cytometry: 1:50-1:200 dilution range
Documentation:
Record lot number and dilution in laboratory notebooks
Document optimization experiments for reproducibility
GON7 expression may vary significantly across cell types. To account for this heterogeneity:
Reference datasets:
Consult protein atlases and transcriptomic databases for expected expression patterns
Compare your findings with published literature on GON7 expression
Cell type markers:
Co-stain for cell type-specific markers alongside GON7
Use multiplexed approaches to correlate GON7 expression with cell identity
Single-cell approaches:
Consider single-cell analysis techniques to resolve heterogeneous populations
Use flow cytometry or single-cell sequencing to correlate GON7 with cell states
Controls and calibration:
Include multiple cell types with known GON7 expression levels
Use standardized positive controls across experiments
High background in GON7 immunostaining can compromise data interpretation. Systematic troubleshooting approaches include:
Antibody-related adjustments:
Further dilute primary antibody
Reduce incubation time or temperature
Try alternative GON7 antibodies validated for the application
Blocking optimizations:
Increase blocking reagent concentration (5-10% BSA or serum)
Extend blocking time (2-3 hours or overnight)
Add 0.1-0.3% Triton X-100 to reduce hydrophobic interactions
Washing modifications:
Increase number and duration of wash steps
Use detergent (0.05-0.1% Tween-20) in wash buffers
Consider using automated washers for consistency
Sample preparation improvements:
Optimize fixation conditions
Consider antigen retrieval methods
Fresh preparation of all solutions
Validation studies of antibodies against various targets, including those using knockout controls, highlight the importance of these optimization steps for reducing background interference .
When GON7 antibodies detect bands at unexpected molecular weights:
Potential biological explanations:
Post-translational modifications (phosphorylation, glycosylation)
Splice variants or isoforms
Proteolytic processing
Protein complexes (if samples not fully denatured)
Technical considerations:
Verification approaches:
Mass spectrometry identification of unexpected bands
Immunoprecipitation followed by Western blot
Treatment with phosphatases or glycosidases to assess modifications