GON7 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to GON7 Antibodies

GON7 antibodies are immunoreagents designed to detect and quantify the GON7 protein (UniProt ID: Q9BXV9), a 100-amino acid intrinsically disordered protein that becomes structured upon binding to the LAGE3 subunit within the KEOPS complex . These antibodies enable researchers to investigate GON7's role in tRNA modification, cell proliferation, and disease pathogenesis, particularly in GAMOS and related disorders.

Functional Insights

  • Cellular Proliferation Studies: Knockdown of GON7 in human podocytes reduces cell proliferation, as demonstrated using RNA interference and antibody-based protein detection .

  • t6A Biosynthesis Assays: GON7 antibodies have been employed to confirm the absence of GON7 protein in fibroblasts from GAMOS patients with GON7 nonsense mutations (e.g., p.Tyr7*), correlating with reduced t6A levels .

Immunogen Design

  • The Aviva Systems Biology antibody (ARP69018_P050) targets a synthetic peptide from the C-terminal region (residues 79–100: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS), which shares 86% homology with cow and dog orthologs .

Validation Data

  • Western Blot: Detects endogenous GON7 at ~11 kDa in human cell lysates .

  • Immunohistochemistry: Atlas Antibodies’ HPA051832 shows nuclear and cytoplasmic staining in human kidney tissue .

Clinical Relevance

GON7 antibodies have been instrumental in diagnosing and characterizing GAMOS. For example:

  • Founder Mutation Detection: A homozygous GON7 mutation (c.21C>A, p.Tyr7*) was identified in multiple Algerian families using antibody-based protein analysis, confirming the absence of GON7 expression .

  • Functional Rescue Experiments: Complementation assays in yeast Δgon7 strains demonstrated that human GON7 mutants fail to restore t6A biosynthesis, underscoring the necessity of functional GON7 .

Challenges and Future Directions

While existing antibodies are critical for basic research, their utility in clinical diagnostics remains limited due to:

  • Specificity Issues: Cross-reactivity with disordered protein regions requires rigorous validation.

  • Quantitative Limitations: Current antibodies lack standardized protocols for absolute quantification in patient samples.

Future studies should focus on developing monoclonal antibodies with higher specificity and integrating GON7 detection into multi-omics platforms for precision medicine applications.

Product Specs

Buffer
Preservative: 0.03% ProClin 300; Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
14-16 weeks (Made-to-order)
Synonyms
GON7 antibody; AEL144WEKC/KEOPS complex subunit GON7 antibody
Target Names
GON7
Uniprot No.

Target Background

Function
The GON7 antibody targets GON7, a component of the EKC/KEOPS complex. This complex is essential for the formation of a threonylcarbamoyl group (t⁶A37) on adenosine at position 37 in tRNAs recognizing adenine-initiated codons. The mechanism involves the transfer of the threonylcarbamoyl moiety from threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37, a process likely facilitated by GON7's supporting role to the catalytic subunit KAE1. Furthermore, the EKC/KEOPS complex plays a crucial role in telomere maintenance, promoting both uncapping and elongation, and is required for efficient transcriptional coactivator recruitment.
Database Links
Protein Families
GON7 family
Subcellular Location
Nucleus. Chromosome, telomere.

Q&A

What is GON7 and why is it significant in research?

GON7 (also known as C14orf142) is a protein of interest in human cellular biology. It functions as a component of the KEOPS complex involved in tRNA modification. Understanding GON7's expression patterns and interactions requires specific antibodies validated for research applications. The antibody against human GON7 enables researchers to study its expression patterns, cellular localization, and potential roles in various biological processes . Research using GON7 antibodies typically employs techniques such as immunohistochemistry (IHC), immunocytochemistry-immunofluorescence (ICC-IF), and Western blotting (WB) to investigate this protein's functions.

What validation techniques confirm GON7 antibody specificity?

Rigorous validation is essential for ensuring antibody specificity. For GON7 antibodies, the gold standard validation approach involves using knockout cell lines as negative controls. This methodology, as demonstrated in large-scale antibody validation studies, allows researchers to confidently determine whether bands detected in Western blots represent authentic GON7 protein or non-specific binding .

The following table outlines the recommended validation approaches for GON7 antibodies:

Validation MethodImplementationAdvantagesLimitations
Knockout validationTesting antibody on GON7 knockout vs. wild-type cellsDefinitive specificity confirmationRequires development of knockout lines
Knockdown validationsiRNA or shRNA against GON7 mRNALess resource-intensive than knockoutIncomplete knockdown can complicate interpretation
Peptide blockingPre-incubation with immunizing peptideSimple to implementLimited specificity confirmation
Multiple antibody concordanceCompare results from different GON7 antibodiesStrengthens confidence in observationsRequires multiple validated antibodies

Which applications are GON7 antibodies validated for?

Commercially available GON7 antibodies undergo validation for specific applications. The rabbit polyclonal GON7 antibody from Atlas Antibodies, for example, is validated for immunohistochemistry (IHC), immunocytochemistry-immunofluorescence (ICC-IF), and Western blot (WB) applications . During experimental design, researchers should confirm that their selected antibody has been specifically validated for their intended application.

What is the recommended antibody concentration for different applications?

GON7 antibodies are typically available at concentrations such as 0.1 mg/ml , but the optimal working dilution varies by application. The table below provides general guidelines for GON7 antibody applications:

ApplicationTypical Dilution RangeStarting Dilution RecommendationOptimization Strategy
Western Blot1:500 - 1:50001:1000Serial dilutions to optimize signal-to-noise ratio
IHC/ICC-IF1:50 - 1:5001:100Titration experiments with both positive and negative controls
Flow Cytometry1:50 - 1:2001:100Fluorescence-minus-one controls for accurate gating
IP/Co-IP1:50 - 1:2001:100Pre-clearing lysates to reduce non-specific binding

How can knockout validation improve GON7 antibody experimental design?

Knockout validation represents a critical approach for confirming antibody specificity. Large-scale antibody validation studies have demonstrated that comparing antibody performance between parental and knockout cell lines provides definitive evidence of specificity . For GON7 antibody experiments, implementing this validation approach involves:

  • Developing GON7 knockout cell lines using CRISPR-Cas9 or similar gene editing technologies

  • Running parallel experiments with wild-type and knockout cells

  • Analyzing band patterns in Western blots to identify true GON7 signals versus non-specific binding

  • Documenting this validation comprehensively in research publications

In studies where developing knockout lines is infeasible, alternative approaches include using published knockout validation data, siRNA knockdown validation, or comparing results across multiple antibodies targeting different GON7 epitopes.

What approaches help resolve contradictory results when using different GON7 antibodies?

When different GON7 antibodies yield inconsistent results, a systematic troubleshooting approach is essential. Contradictory results often stem from differences in epitope recognition, specificity, or technical factors. Researchers should:

  • Compare the epitopes recognized by each antibody (N-terminal, C-terminal, or internal domains)

  • Assess validation documentation for each antibody, prioritizing those with knockout validation

  • Evaluate whether post-translational modifications might affect epitope recognition

  • Consider whether splice variants of GON7 might explain differential recognition patterns

  • Implement side-by-side testing under identical conditions with appropriate positive and negative controls

Standardized validation approaches similar to those used in comprehensive antibody assessment studies can help resolve such contradictions by systematically evaluating each antibody's specificity and sensitivity .

How do different fixation methods affect GON7 antibody performance in immunohistochemistry?

Fixation methods significantly impact antibody performance in immunohistochemistry and immunocytochemistry. For GON7 antibodies, researchers should consider:

Fixation MethodImpact on GON7 DetectionRecommended ProtocolConsiderations
Paraformaldehyde (4%)Preserves morphology with moderate epitope masking15-20 minutes at room temperatureMay require antigen retrieval
MethanolExposes some epitopes while masking others10 minutes at -20°CCompromises membrane structures
AcetoneRapid fixation with less cross-linking5-10 minutes at -20°CMay not preserve fine structural details
GlutaraldehydeStrong fixation for electron microscopy0.1-2.5% in bufferOften causes high autofluorescence
Combined PFA/methanolBalances preservation and accessibilitySequential applicationMay provide optimal results for some epitopes

Optimization experiments comparing these fixation methods are recommended when establishing new GON7 immunostaining protocols.

What is the recommended protocol for Western blot using GON7 antibodies?

For optimal Western blot results with GON7 antibodies, the following protocol is recommended:

  • Sample preparation:

    • Lyse cells in RIPA buffer supplemented with protease inhibitors

    • Quantify protein concentration (BCA or Bradford assay)

    • Prepare samples (20-40 μg total protein) in reducing Laemmli buffer

    • Heat samples at 95°C for 5 minutes

  • Gel electrophoresis and transfer:

    • Separate proteins on 10-12% SDS-PAGE gels

    • Transfer to PVDF membranes (nitrocellulose is a suitable alternative)

    • Verify transfer efficiency with Ponceau S staining

  • Immunodetection:

    • Block membranes with 5% non-fat milk or BSA in TBST for 1 hour at room temperature

    • Incubate with GON7 antibody (typically 1:1000 dilution) overnight at 4°C

    • Wash 3× with TBST, 5 minutes each

    • Incubate with HRP-conjugated secondary antibody (1:5000) for 1 hour at room temperature

    • Wash 3× with TBST, 5 minutes each

    • Develop using ECL substrate and appropriate imaging system

  • Controls:

    • Include positive control (cell line known to express GON7)

    • Include negative control (GON7 knockout cells if available)

    • Use loading control (GAPDH, β-actin, or similar housekeeping protein)

How can I optimize immunoprecipitation protocols with GON7 antibodies?

Immunoprecipitation (IP) with GON7 antibodies allows for the isolation of GON7 and its interaction partners. For optimal results:

  • Pre-clearing lysate:

    • Incubate cell lysate with protein A/G beads for 1 hour at 4°C

    • Remove beads by centrifugation to reduce non-specific binding

  • Antibody binding:

    • Add 2-5 μg of GON7 antibody to 500 μg of pre-cleared lysate

    • Incubate overnight at 4°C with gentle rotation

  • Immunocapture:

    • Add 30-50 μl of protein A/G beads

    • Incubate for 2-4 hours at 4°C with gentle rotation

    • Wash beads 4-5 times with cold lysis buffer

  • Elution and analysis:

    • Elute proteins by boiling in Laemmli buffer

    • Analyze by Western blot using verified antibodies

  • Controls:

    • Include an isotype control antibody IP

    • Analyze input, unbound, and IP fractions

    • Consider using knockout cells as negative controls

What are the key methodological controls when using GON7 antibodies?

Proper controls are essential for generating reliable data with GON7 antibodies. Based on standardized antibody validation approaches, researchers should implement the following controls :

Control TypePurposeImplementation
Positive controlConfirms ability to detect GON7Use cell lines/tissues with known GON7 expression
Negative controlAssesses non-specific bindingUse GON7 knockout cells or tissues
Technical controlsEvaluate procedure integrityPrimary antibody omission, isotype controls
Loading controlsEnsure equal sample loadingHousekeeping proteins (GAPDH, β-actin)
Knockdown validationConfirms signal specificitysiRNA targeting GON7 to reduce signal
Peptide competitionVerifies epitope specificityPre-incubate antibody with immunizing peptide

How should I quantify and normalize GON7 expression data?

Accurate quantification of GON7 expression requires appropriate normalization and statistical analysis. Recommended approaches include:

  • For Western blot quantification:

    • Use densitometry to measure band intensity

    • Normalize GON7 signal to loading controls (GAPDH, β-actin, total protein)

    • Include biological replicates (n≥3) for statistical analysis

    • Report data as fold change relative to control conditions

  • For immunofluorescence quantification:

    • Measure average fluorescence intensity within defined cellular regions

    • Normalize to cell area or nuclear staining

    • Analyze sufficient cell numbers (typically >30 cells per condition)

    • Use appropriate statistical tests (t-test, ANOVA) based on data distribution

  • For flow cytometry:

    • Report median fluorescence intensity rather than mean

    • Use fluorescence-minus-one controls for gating

    • Normalize to unstained or isotype controls

  • For immunohistochemistry:

    • Use standardized scoring systems (H-score, Allred score)

    • Blind scorers to experimental conditions

    • Implement positive and negative tissue controls

How can I determine the appropriate antibody concentration for my specific application?

Determining optimal antibody concentration requires systematic titration experiments. For GON7 antibodies, which are typically supplied at concentrations around 0.1 mg/ml , consider:

  • Titration strategy:

    • Start with manufacturer's recommended dilution

    • Test 3-5 dilutions spanning 2-3 orders of magnitude

    • Include positive and negative controls at each dilution

  • Evaluation criteria:

    • Signal-to-noise ratio (specific vs. non-specific signal)

    • Consistency across replicate samples

    • Minimal background in negative controls

  • Application-specific considerations:

    • Western blot: 1:500-1:5000 dilution range

    • IHC/ICC: 1:50-1:500 dilution range

    • Flow cytometry: 1:50-1:200 dilution range

  • Documentation:

    • Record lot number and dilution in laboratory notebooks

    • Document optimization experiments for reproducibility

How do I account for cell-type specific expression patterns when interpreting GON7 results?

GON7 expression may vary significantly across cell types. To account for this heterogeneity:

  • Reference datasets:

    • Consult protein atlases and transcriptomic databases for expected expression patterns

    • Compare your findings with published literature on GON7 expression

  • Cell type markers:

    • Co-stain for cell type-specific markers alongside GON7

    • Use multiplexed approaches to correlate GON7 expression with cell identity

  • Single-cell approaches:

    • Consider single-cell analysis techniques to resolve heterogeneous populations

    • Use flow cytometry or single-cell sequencing to correlate GON7 with cell states

  • Controls and calibration:

    • Include multiple cell types with known GON7 expression levels

    • Use standardized positive controls across experiments

What strategies can resolve high background in GON7 immunostaining?

High background in GON7 immunostaining can compromise data interpretation. Systematic troubleshooting approaches include:

  • Antibody-related adjustments:

    • Further dilute primary antibody

    • Reduce incubation time or temperature

    • Try alternative GON7 antibodies validated for the application

  • Blocking optimizations:

    • Increase blocking reagent concentration (5-10% BSA or serum)

    • Extend blocking time (2-3 hours or overnight)

    • Add 0.1-0.3% Triton X-100 to reduce hydrophobic interactions

  • Washing modifications:

    • Increase number and duration of wash steps

    • Use detergent (0.05-0.1% Tween-20) in wash buffers

    • Consider using automated washers for consistency

  • Sample preparation improvements:

    • Optimize fixation conditions

    • Consider antigen retrieval methods

    • Fresh preparation of all solutions

Validation studies of antibodies against various targets, including those using knockout controls, highlight the importance of these optimization steps for reducing background interference .

How should discrepancies in molecular weight detection be interpreted with GON7 antibodies?

When GON7 antibodies detect bands at unexpected molecular weights:

  • Potential biological explanations:

    • Post-translational modifications (phosphorylation, glycosylation)

    • Splice variants or isoforms

    • Proteolytic processing

    • Protein complexes (if samples not fully denatured)

  • Technical considerations:

    • Confirm protein ladder calibration

    • Validate with knockout controls to identify true GON7 bands

    • Compare detection patterns across multiple GON7 antibodies

  • Verification approaches:

    • Mass spectrometry identification of unexpected bands

    • Immunoprecipitation followed by Western blot

    • Treatment with phosphatases or glycosidases to assess modifications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.