GPC5 Antibody

What is GPC5 and what are its characteristic properties?

Glypican-5 (GPC5) is a cell surface heparan sulfate proteoglycan anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) anchor. In humans, the canonical protein consists of 572 amino acid residues with a molecular mass of approximately 63.7 kDa . GPC5 belongs to the glypican family, which includes six members in mammals. It is widely expressed across various tissue types, with particularly high expression in the brain and testis . As a proteoglycan, GPC5 undergoes significant post-translational modifications, most notably glycosylation . Its subcellular localization is primarily in the cell membrane, and it serves as a marker for identifying brain astrocytes according to the HuBMAP Human Reference Atlas .

What are the primary applications of GPC5 antibodies in research?

GPC5 antibodies have demonstrated utility across multiple experimental techniques:

When selecting an application, researchers should consider the antibody's validation data for their specific technique. Western blot has been the most extensively validated application across various antibodies, with ELISA being the second most common .

How is GPC5 expression regulated in normal and disease states?

GPC5 expression is developmentally regulated and tissue-specific. It plays essential roles in kidney, limb, and brain development . Expression analysis reveals:

• High expression in normal brain and testis tissues

• Variable expression across cancer types with context-dependent patterns

• Significantly lower expression in lung adenocarcinoma compared to matched normal lung tissue

• Progressive downregulation in Alzheimer's disease (AD) patients and mouse models

• Increased expression in diabetic glomeruli, proportional to disease severity

Interestingly, GPC5 displays a dual role in cancer progression. In lung cancer, GPC5 gene-expression levels in normal lung tissues are significantly lower in individuals carrying high-risk alleles, suggesting a tumor suppressor function . In contrast, GPC5 stimulates the proliferation of rhabdomyosarcoma cells by promoting Hedgehog signaling, indicating an oncogenic role in this context .

What mechanisms explain GPC5's contrasting roles in different cancer types?

The functional versatility of GPC5 in cancer appears to depend on tissue context and signaling pathway interactions:

In lung cancer, particularly adenocarcinoma:

• GPC5 expression is significantly downregulated compared to normal lung tissue

• Lower expression is associated with never-smokers compared to smokers

• Two independent datasets showed significant downregulation of GPC5 in adenocarcinoma tumors compared with normal lung tissue

• This pattern appears specific to adenocarcinoma, as other histological types (carcinoid, squamous, small-cell, and large-cell carcinoma) showed no significant differences

In rhabdomyosarcoma:

• GPC5 is amplified in ~20% of patients with alveolar rhabdomyosarcoma

• GPC5 stimulates Hedgehog signaling by increasing the binding of Sonic Hedgehog (Shh) to Patched 1 (Ptc1)

• This stimulatory effect is mediated through GPC5's glycosaminoglycan chains, which bind to both Shh and Ptc1

• GPC5 localizes to primary cilia, unlike other glypicans like GPC3

The differential effects likely stem from:

• Tissue-specific co-receptor expression patterns

• Varying glycosaminoglycan (GAG) chain compositions (GPC5 displays higher sulfation than GPC3)

• Context-dependent interactions with different signaling pathways (Hedgehog, Wnt, FGF)

How can I optimize GPC5 antibody staining in FFPE tissue?

Formalin-fixed paraffin-embedded (FFPE) tissue presents challenges for GPC5 immunodetection. Based on methodological research:

• Optimal antigen retrieval method:

  • Heat-induced antigen retrieval in sodium citrate buffer (pH 6.0) produces the best results

  • Enzyme-mediated retrieval is not recommended as it produces weaker, less well-localized GPC5 expression

• Protocol optimization steps:

  • Use freshly cut sections (4-6 μm thickness) for best results

  • Deparaffinize completely to reduce background

  • Heat-induced antigen retrieval should be carefully timed (typically 10-20 minutes)

  • Primary antibody concentration should be optimized (1:200-1:500 range is typically effective)

  • Secondary detection systems should be carefully selected based on desired sensitivity

• Controls and validation:

  • Brain and testis tissues serve as effective positive controls due to high endogenous expression

  • Isogenic cell lines with GPC5 overexpression are valuable for antibody validation

  • Negative controls should include omission of primary antibody and ideally GPC5-null tissues

This methodology yields specific cellular localization and good staining intensity with minimal background staining .

How does GPC5 contribute to synaptic function in normal and Alzheimer's disease states?

Recent research has identified GPC5 as a critical regulator of synaptic function with therapeutic potential in Alzheimer's disease:

• Normal synaptic function:

  • GPC5 regulates synapses by affecting presynaptic terminal size

  • It influences postsynaptic recruitment of GluA2-containing AMPA receptors

  • Astrocyte-expressed GPC5 plays a role in maintaining proper synaptic activity levels

• Role in Alzheimer's disease:

  • GPC5 is significantly downregulated in AD patients and mouse models

  • Expression is particularly reduced in reactive astrocytes around amyloid plaques

  • The progressive downregulation correlates with disease progression (observed at 4, 6, and 12 months in APP mouse model)

• Experimental evidence for therapeutic potential:

  • In vivo overexpression of GPC5 in astrocytes prevented early synaptic hippocampal hyperactivity in APP mice

  • GPC5 overexpression improved spatial learning in APP mice at 6 months

  • The mechanism involves upregulation of postsynaptic GluA2 AMPA receptors

  • A significant positive correlation exists between the number of GPC5-overexpressing astrocytes and GluA2 levels (Pearson correlation 0.46, p=0.04)

These findings suggest that GPC5 represents a potential therapeutic target for early intervention in Alzheimer's disease, particularly for addressing synaptic dysfunction.

What are the best practices for validating GPC5 antibody specificity?

Rigorous validation is essential for ensuring experimental reproducibility with GPC5 antibodies:

• Multi-technique validation approach:

  • Western blot to confirm molecular weight (expected ~64kDa, though glycosylation can affect migration)

  • Immunohistochemistry in tissues with known expression patterns (brain, testis)

  • Flow cytometry with proper controls (isotype and unstained)

  • RNA interference to confirm signal reduction with GPC5 knockdown

• Cross-reactivity testing:

  • Against other glypican family members (particularly important for polyclonal antibodies)

  • Testing in GPC5-null or GPC5-overexpressing cell lines

  • Testing across multiple relevant species when performing comparative studies

• Enhanced validation techniques:

  • Orthogonal RNAseq validation (comparing protein detection with RNA expression)

  • Independent antibody validation (using antibodies targeting different epitopes)

  • Mass spectrometry confirmation of immunoprecipitated proteins

For example, the recently developed G5Mab-1 monoclonal antibody was rigorously validated using the Cell-Based Immunization and Screening method. It demonstrated specific binding only to GPC5, not to other GPC family members, with a dissociation constant of 9.9 × 10^-9 M for CHO/GPC5 cells .

How do I select the appropriate GPC5 antibody for my specific research application?

Selection criteria should be tailored to your experimental goals:

• Antibody type considerations:

  • Polyclonal antibodies: Better for detecting native proteins and providing stronger signals, but may have batch-to-batch variability

  • Monoclonal antibodies: Offer higher specificity and reproducibility, ideal for quantitative applications

  • Single domain antibodies: Useful for accessing cryptic epitopes and applications requiring small antibody size

• Application-specific selection:

  • For WB: Select antibodies with validated performance in denaturing conditions

  • For IHC-FFPE: Choose antibodies specifically validated in fixed tissue

  • For flow cytometry: Select antibodies that recognize extracellular epitopes

  • For functional studies: Consider neutralizing antibodies that target functional domains

• Epitope targeting strategy:

  • For detection of all GPC5 isoforms: Target conserved regions

  • For detection of specific post-translational modifications: Choose antibodies targeting modified regions

  • For functional studies: Target domains involved in specific interactions (e.g., Hedgehog binding)

The immunogen sequence can provide important information about the antibody's target region. For example, the CAB10411 antibody targets amino acids 320-550 of human GPC5 (NP_004457.1) , while another antibody (HPA040152) targets the sequence: AELNPHWHAYIRSLEELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVRTPTQSPRCSFDQSKEKHGMKTTTRN .

What experimental approaches can resolve contradictory findings regarding GPC5 function?

The dual role of GPC5 across different diseases and tissues requires careful experimental design:

• Context-specific experimentation:

  • Use tissue-relevant cell models (primary cells where possible)

  • Consider 3D culture systems that better recapitulate in vivo conditions

  • Account for the microenvironment by including relevant stromal components

• Pathway-focused analysis:

  • Examine GPC5 interactions with multiple signaling pathways simultaneously

  • Assess GPC5 in the context of Hedgehog, Wnt, and FGF signaling

  • Consider how GPC5 glycosaminoglycan composition affects pathway specificity

• Structure-function dissection:

  • Generate domain-specific mutations or truncations

  • Separately analyze the core protein versus glycosaminoglycan chains

  • Consider the degree of sulfation, which differs significantly between GPC5 and other glypicans

• Disease model considerations:

  • Use multiple model systems (cell lines, organoids, animal models)

  • Ensure developmental timing is appropriate (many glypicans have stage-specific functions)

  • Consider sex as a biological variable (though current evidence suggests minimal sex effects on GPC5-related pathways)

• Technical reconciliation approaches:

  • Use multiple antibodies targeting different epitopes

  • Combine protein and RNA analysis techniques

  • Implement genetic approaches (CRISPR, RNAi) alongside antibody-based methods

How can I study the role of GPC5 glycosaminoglycan chains independently from the core protein?

The glycosaminoglycan (GAG) chains of GPC5 play critical roles in its function that differ from its core protein:

• Experimental strategies for GAG-specific analysis:

  • Enzymatic removal of GAG chains using heparinase treatment

  • Site-directed mutagenesis of GAG attachment sites

  • Comparison of fully glycosylated versus core-only GPC5 constructs

  • Use of HS20 antibody or similar tools that specifically target the HS chains

• Functional analysis approaches:

  • Binding assays comparing native versus GAG-depleted GPC5

  • Co-immunoprecipitation studies with pathway components

  • Cellular localization studies (GPC5 localizes to primary cilia, unlike GPC3)

  • Signaling pathway reporter assays with modified GPC5 variants

• Biochemical characterization:

  • Analysis of sulfation patterns, which are particularly important for GPC5 function

  • GPC5 HS chains display a significantly higher degree of sulfation than those of GPC3

  • Disaccharide composition analysis of purified GPC5

The significance of GAG chains is highlighted by research showing that GPC5 binds to both Hedgehog (Hh) and Patched 1 (Ptc1) through its glycosaminoglycan chains, unlike GPC3, which binds to Hedgehog through its core protein . This difference in binding mechanism explains their opposing effects on Hedgehog signaling.

What therapeutic applications are being developed targeting GPC5?

GPC5-targeted therapies are in early research stages, with several promising approaches:

• In Alzheimer's disease:

  • Viral vector-mediated GPC5 overexpression in astrocytes has shown promise in mouse models

  • Research demonstrated prevention of early synaptic hippocampal hyperactivity

  • Improved spatial learning was observed in the APP mouse model at 6 months

• In cancer contexts:

  • Approach depends on tumor type, given GPC5's dual role

  • For tumors where GPC5 is oncogenic (e.g., rhabdomyosarcoma), potential approaches include:

    • Neutralizing antibodies targeting the Hedgehog-binding domain

    • Small molecules disrupting GPC5-Hedgehog interactions

    • GAG-modifying enzymes to alter GPC5 function

• In diabetic kidney disease:

  • GPC5 increases susceptibility to nephrotic damage in diabetic kidneys

  • Expression increases proportionally to diabetes severity

  • Targeting GPC5 may offer protection against diabetic nephropathy

While GPC5-directed therapies remain experimental, significant progress has been made with other glypican family members, particularly GPC3-targeted approaches for hepatocellular carcinoma, which may provide a roadmap for GPC5-focused therapeutic development .

How does GPC5 interact with other glypican family members in regulating cell signaling?

Research into glypican cross-talk reveals complex interactions:

• Comparative signaling effects:

  • GPC5 stimulates Hedgehog signaling, while GPC3 inhibits it

  • This opposing effect stems from different binding mechanisms:

    • GPC5 binds Hedgehog and Patched 1 via GAG chains, facilitating their interaction

    • GPC3 binds Hedgehog via its core protein, competing with Patched 1

• Co-expression patterns:

  • Glypicans often show overlapping but distinct tissue expression

  • Functional redundancy may exist between some family members

  • Competition for shared signaling partners likely occurs in co-expressing cells

• Pathway-specific interactions:

  • In FGF signaling: GPC5 enhances intracellular FGF2 signaling and alters cellular distribution of FGF2

  • In Wnt signaling: Multiple glypicans participate with context-dependent effects

  • In Hedgehog signaling: GPC5 and GPC3 have opposing effects

Understanding these complex interactions requires systems biology approaches that consider the entire glypican network rather than studying GPC5 in isolation.

What are the latest methodological advances in studying GPC5 in neural function?

Neural function research on GPC5 benefits from several innovative approaches:

• Advanced imaging techniques:

  • Super-resolution microscopy to visualize GPC5 at synapses

  • Live-cell imaging to track GPC5 dynamics during synaptic activity

  • Combined electrophysiology and imaging approaches

• Astrocyte-specific manipulation:

  • AAV.PHP.eB viral vectors for selective astrocyte targeting

  • Astrocyte-specific promoters for cell-type specific manipulation

  • In vivo overexpression systems for functional assessment

• Behavioral assessment methods:

  • Barnes maze testing for spatial learning assessment

  • Reversal learning paradigms to evaluate cognitive flexibility

  • Comprehensive battery approach to assess multiple cognitive domains

• Single-cell approaches:

  • Single-molecule RNA in situ hybridization combined with immunofluorescence

  • Single-cell transcriptomics to identify cell-specific alterations in GPC5 expression

  • Patch-clamp electrophysiology to assess synaptic function

Recent research demonstrated that overexpressing GPC5 in astrocytes in vivo prevented early synaptic hippocampal hyperactivity in APP mice by measuring spontaneous excitatory postsynaptic currents (sEPSCs), finding reduced frequency in GPC5-overexpressing APP mice compared to controls .

What are the most promising directions for future GPC5 antibody development?

Next-generation GPC5 antibodies will likely feature:

• Enhanced specificity and versatility:

  • Antibodies with validated cross-species reactivity for comparative studies

  • Conformation-specific antibodies that distinguish active versus inactive states

  • Single-domain antibodies that target cryptic or conserved epitopes

• Novel applications and formats:

  • Bispecific antibodies targeting GPC5 and relevant signaling partners

  • Therapeutic-grade neutralizing antibodies with optimized pharmacokinetics

  • Modified antibody formats for enhanced tissue penetration (especially for CNS applications)

• Advanced conjugates and detection systems:

  • Multi-color imaging compatible conjugates

  • Proximity labeling antibodies for identifying GPC5 interaction partners

  • PROTAC/degrader conjugates for targeted protein degradation

The recent development of the G5Mab-1 monoclonal antibody using Cell-Based Immunization and Screening methods represents a significant advance, offering versatility across multiple applications with high specificity . Similar methodological approaches will likely yield improved reagents in the coming years.

How might GPC5 research inform our understanding of broader proteoglycan biology?

GPC5 research provides unique insights into proteoglycan function:

• Structure-function relationships:

  • The differential effects of GPC5 versus GPC3 in Hedgehog signaling demonstrates how subtle structural differences can completely reverse functional outcomes

  • The higher degree of sulfation on GPC5's heparan sulfate chains compared to GPC3 highlights the importance of GAG modifications beyond mere presence/absence

• Developmental context-dependency:

  • GPC5's essential roles in kidney, limb, and brain development illuminate how proteoglycans orchestrate tissue morphogenesis

  • Temporal regulation of expression suggests stage-specific functions

• Signaling network integration:

  • GPC5's involvement in multiple pathways (Hedgehog, Wnt, FGF) demonstrates how proteoglycans serve as signaling hubs

  • Context-dependent outcomes suggest complex integration with the broader signaling environment

• Therapeutic targeting principles:

  • The functional duality of GPC5 in disease contexts (oncogenic in some cancers, tumor-suppressive in others) highlights the importance of context-specific targeting approaches

  • Success with GPC5 manipulation in Alzheimer's model systems suggests broader applications for proteoglycan-targeted therapies

These insights will inform not only GPC5-specific research but also guide approaches to understanding and manipulating other proteoglycans in development and disease.