GPR108 antibodies are immunological reagents specifically designed to detect and bind to G protein-coupled receptor 108 (GPR108), a protein of increasing interest in multiple research domains. These antibodies serve as crucial tools for investigating GPR108 expression, localization, and function in various biological contexts. Commercial GPR108 antibodies are typically produced in rabbits as polyclonal antibodies, and they have been characterized for specific research applications including immunohistochemistry and western blotting .
These antibodies recognize specific amino acid sequences within the GPR108 protein, allowing researchers to study this protein in human, mouse, and rat systems, depending on the specific antibody . The development of these antibodies has facilitated research into the biological roles of GPR108, particularly in innate immunity regulation and as a cellular entry factor for adeno-associated viruses.
Understanding the target protein is essential for appreciating the utility of GPR108 antibodies. GPR108 is a member of the G protein-coupled receptor superfamily with several notable characteristics:
GPR108 is primarily localized to the trans-Golgi network (TGN), similar to its homolog GPR107 . Unlike GPR107, which contains a furin cleavage site in its N-terminal domain, GPR108 appears to migrate at the expected molecular weight of the full-length protein, suggesting it lacks an analogous cleavage site . Both the N-terminal and C-terminal domains of GPR108 are essential for its biological functions, particularly in mediating adeno-associated virus (AAV) entry .
GPR108 has been identified as a potent nuclear factor kappa B (NF-κB) activator that negatively regulates Toll-like receptor (TLR) signaling . Research has demonstrated that GPR108 modulates immune responses initiated by TLRs through interactions with TLR adaptor protein MyD88 and TRAF6 . Additionally, GPR108 has been recognized as a highly conserved entry factor for adeno-associated viruses across multiple species .
This antibody is produced in rabbits as part of the Prestige Antibodies collection powered by Atlas Antibodies . It is an affinity-isolated polyclonal antibody supplied in a buffered aqueous glycerol solution. The antibody specifically recognizes human GPR108 and is recommended for immunohistochemistry applications at dilutions of 1:20 to 1:50 . The immunogen used for generating this antibody is a specific peptide sequence: SKPKSTPAVIQGPSGKDEDLVLGLSHLNNSYNFSFHVVIGSQAEEGQYSLNFHNCNNSVPGKEHPFDITVMIREKNPDG .
This polyclonal antibody is also produced in rabbits and recognizes amino acids 33-260 of human GPR108 . It has demonstrated reactivity with human, mouse, and rat GPR108, making it valuable for cross-species comparative studies . This antibody is primarily recommended for western blotting applications and was generated using a recombinant fusion protein containing a sequence corresponding to amino acids 33-260 of human GPR108 .
The table below summarizes the key specifications of these two GPR108 antibodies:
| Characteristic | Sigma-Aldrich HPA041951 | Antibodies-Online ABIN7267291 |
|---|---|---|
| Host | Rabbit | Rabbit |
| Clonality | Polyclonal | Polyclonal |
| Target Species | Human | Human, Mouse, Rat |
| Applications | Immunohistochemistry | Western Blotting |
| Immunogen | Specific peptide sequence | Recombinant fusion protein (aa 33-260) |
| Format | Buffered aqueous glycerol solution | Unconjugated |
| Storage | -20°C | Not specified |
GPR108 antibodies have proven valuable in various research applications, contributing to our understanding of this protein's biological roles:
The Sigma-Aldrich anti-GPR108 antibody has been extensively validated for immunohistochemistry as part of the Human Protein Atlas project . This application allows researchers to visualize the expression and distribution of GPR108 in various human tissues, contributing to the mapping of the human proteome at both tissue and subcellular levels .
The Antibodies-Online GPR108 antibody is recommended for western blotting applications, enabling researchers to detect and quantify GPR108 protein expression in cell and tissue lysates . This application has been essential for studies examining GPR108 expression levels in different experimental conditions.
GPR108 antibodies have facilitated research into this protein's role in innate immunity regulation. Studies have used these antibodies to investigate how GPR108 modulates TLR signaling and affects the production of proinflammatory cytokines and interferons .
Another significant application of GPR108 antibodies is in studying the role of GPR108 as an entry factor for adeno-associated viruses (AAVs). These antibodies have helped researchers elucidate the mechanisms by which GPR108 facilitates AAV transduction across various cell types and species .
Several important research findings have been facilitated by the use of GPR108 antibodies:
Research utilizing GPR108 antibodies has revealed that GPR108 serves as an NF-κB activator that negatively regulates TLR signaling . Studies in GPR108-null mice have demonstrated enhanced cytokine secretion and NF-κB and IRF3 signaling, while GPR108-null macrophages reconstituted with GPR108 exhibited blunted signaling . These findings suggest GPR108 plays a regulatory role in keeping TLR-mediated immune responses within an appropriate range.
GPR108 antibodies have been instrumental in identifying GPR108 as a highly conserved entry factor for adeno-associated viruses . Research has shown that of more than 20 divergent AAVs tested across all AAV clades, only AAV5 transduction was unaffected in GPR108 knockout cell lines . Both in vitro and in vivo studies demonstrated that GPR108 knockout resulted in 10- to 100-fold reduced expression for AAV8 and rh32.33 but not AAV5 .
Studies utilizing GPR108 antibodies have provided mechanistic insights into how this protein functions:
GPR108 competition with TLR4 to bind to MyD88 by modulating the E3 ligase TRAF6, which mediates ubiquitination of MyD88
The role of both N- and C-terminal domains of GPR108 in mediating AAV transduction
The involvement of GPR108 in viral entry steps upstream of nuclear import, with evidence suggesting that AAV may be degraded in the absence of required cellular entry factors
The localization of GPR108 primarily to the trans-Golgi network, consistent with its role in viral entry
Research using GPR108 antibodies continues to evolve, with several promising directions:
The identification of GPR108 as an AAV entry factor has significant implications for gene therapy applications. AAV vectors are widely used for gene delivery in clinical settings, and understanding the role of GPR108 in AAV entry could inform the development of more efficient gene therapy vectors .
Given GPR108's role in regulating innate immune responses, further research using GPR108 antibodies may reveal potential therapeutic applications in inflammatory and autoimmune conditions . Targeting GPR108 could potentially offer new approaches to modulating immune responses in various disease contexts.
Research has demonstrated that GPR108 usage is conserved between species that are permissive to AAV transduction, with both human and murine GPR108 capable of mediating AAV entry . This conservation has important implications for the development of AAV-based gene therapy models and for understanding the evolutionary significance of GPR108.
GPR108 (G protein-coupled receptor 108) is a 543 amino acid protein with a molecular mass of 60.6 kDa in humans that belongs to the LU7TM protein family . It primarily localizes to the trans-Golgi network (TGN) as demonstrated by co-localization with TGN46 in immunofluorescence studies . GPR108 exhibits seven transmembrane domains characteristic of G-protein coupled receptors and undergoes post-translational modifications, most notably glycosylation . It shares subcellular localization patterns comparable to GPR107, another TGN-localized protein . The protein is also known by synonyms including "lung seven transmembrane receptor 2" and has been identified in multiple species with orthologs reported in mouse, rat, bovine, and chimpanzee genomes .
Multiple methodologies have been validated for GPR108 detection, with Western blotting, immunofluorescence, and immunohistochemistry being the most commonly employed techniques . For RNA-level detection, quantitative PCR following reverse transcription (RT-qPCR) and Reverse Transcription-Multiplex Ligation-dependent Probe Amplification (RT-MLPA) have been successfully implemented to measure GPR108 gene expression across different tissues . When performing immunofluorescence, GPR108 can be visualized using FLAG-tagged constructs containing a 3× glycine-alanine linker at the C-terminus, which permits subcellular localization studies without interfering with protein function . For protein-level detection in fixed tissues, immunohistochemistry on paraffin sections (IHC-p) has proven effective with several commercially available antibodies demonstrating reactivity across human, mouse, rat, and bovine samples .
When validating GPR108 antibodies, researchers should implement several critical controls. First, include GPR108 knockout (KO) cell lines or tissues as negative controls, which can be generated using CRISPR/Cas9 techniques as described in multiple studies . Second, employ overexpression systems with tagged GPR108 constructs as positive controls, specifically using FLAG-tagged or other epitope-tagged versions . Third, include cross-reactivity controls by testing antibodies against related proteins like GPR107, which shares structural similarities but distinct functions . Fourth, perform peptide competition assays to confirm binding specificity to the intended epitope. Additionally, tissue expression panels should be used to verify detection patterns align with known GPR108 distribution, and antibody validation should include multiple detection techniques (Western blot, IF, IHC) to confirm consistent recognition of the target protein across methodologies .
Western blotting for GPR108 requires specific optimization due to its transmembrane nature and post-translational modifications. Begin with proper sample preparation using RIPA buffer supplemented with protease inhibitors and deglycosylation enzymes when analyzing glycosylation patterns. For membrane protein extraction, consider using specialized membrane protein isolation kits. During electrophoresis, use 8-10% polyacrylamide gels to achieve optimal separation of the 60.6 kDa protein. For transfer, employ a semi-dry or wet transfer system with methanol-containing buffer to facilitate transfer of hydrophobic regions. During blocking, use 5% BSA rather than milk, as milk proteins can interfere with detection of certain membrane proteins. For primary antibody incubation, dilute GPR108 antibodies to manufacturer-recommended concentrations (typically 1:500-1:2000) and incubate overnight at 4°C . Always include positive controls (cells known to express GPR108) and negative controls (GPR108 knockout cells generated via CRISPR/Cas9) . Notably, detection of both glycosylated and non-glycosylated forms may result in multiple bands, which should be verified through glycosidase treatment experiments.
For effective immunofluorescence (IF) localization of GPR108, researchers should implement a protocol that preserves Golgi structure while providing adequate antibody access. Begin with 4% paraformaldehyde fixation for 15 minutes at room temperature, followed by a gentle permeabilization step using 0.1-0.2% Triton X-100 or 0.1% saponin to maintain membrane integrity while allowing antibody penetration. For co-localization studies, pair GPR108 staining with established Golgi markers such as TGN46, which has been validated to co-localize with GPR108 . Implement a blocking step using 5% normal serum from the species of the secondary antibody for 1 hour. For primary antibody incubation, dilute GPR108 antibodies to 1:100-1:500 and incubate overnight at 4°C. Use fluorophore-conjugated secondary antibodies at 1:200-1:1000 dilutions, selecting wavelengths that enable multi-color imaging with other markers. To confirm specificity, conduct parallel staining in GPR108 knockout cells and GPR108-FLAG transfected cells as negative and positive controls, respectively . Confocal microscopy with z-stack acquisition is recommended to accurately resolve the three-dimensional localization within the Golgi apparatus.
Multiple complementary techniques should be employed to comprehensively characterize GPR108 protein-protein interactions. Co-immunoprecipitation (Co-IP) has successfully demonstrated interactions between GPR108 and TLR-associated proteins including TIRAP, MyD88, and TRAF6 . For Co-IP, use mild lysis conditions (1% NP-40 or 0.5% CHAPS) to preserve native protein complexes. Proximity ligation assays (PLA) can provide spatial information about interactions in situ, using pairs of antibodies against GPR108 and putative interacting partners. For mapping interaction domains, implement truncation mutants or peptide arrays to identify specific regions mediating protein binding. Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) approaches allow real-time monitoring of interactions in living cells by tagging GPR108 and interaction partners with appropriate donor-acceptor pairs. Crosslinking mass spectrometry can identify interaction interfaces at amino acid resolution. When studying interactions with TLRs or immune signaling components, stimulate cells with appropriate ligands (e.g., LPS for TLR4) and assess how these stimuli dynamically affect GPR108 interaction networks . Control experiments should include competition with excess untagged protein to verify specificity of detected interactions.
GPR108 functions as a critical entry factor for most adeno-associated virus (AAV) serotypes, with its requirement varying significantly across the evolutionary spectrum of AAV variants. Experimental evidence from genome-wide CRISPR screens initially identified GPR108 as essential for AAVrh32.33 entry . Further characterization through knockout studies revealed GPR108 dependency across most AAV serotypes, with AAV5 being the notable exception that maintains transduction capability in GPR108-null cells . The mechanism appears to involve GPR108-mediated viral escape from endosomal or trans-Golgi network compartments, as indicated by subcellular fractionation studies . Specifically, the VP1 unique region (VP1u) of the AAV capsid dictates GPR108 usage, as demonstrated through chimeric virus experiments where swapping the VP1u region between AAV2 and AAV5 transferred GPR108 dependency characteristics . The requirement for GPR108 is conserved across species, with both human and mouse GPR108 supporting AAV transduction, an important consideration for translational gene therapy applications .
To determine GPR108 dependency of AAV transduction, researchers should implement a multi-faceted experimental approach. First, generate GPR108 knockout cell lines using CRISPR/Cas9 technology targeting exons 1 and 13, as validated in previous studies . Confirm knockout efficiency through RT-qPCR and Western blot analysis. Next, conduct comparative transduction assays using luciferase-expressing AAV vectors in wild-type versus GPR108 knockout cells, normalizing for viral genome copy numbers . A 10-100 fold decrease in transduction efficiency in knockout cells would indicate GPR108 dependency . For more definitive evidence, perform rescue experiments by reintroducing GPR108 expression in knockout cells, which should restore transduction capability if the serotype is truly GPR108-dependent. Additionally, create chimeric viruses by swapping VP1u regions between GPR108-dependent and independent serotypes to map the determinants of dependency . For in vivo validation, utilize GPR108 knockout mouse models and quantify transduction efficiency through bioluminescence imaging following systemic administration of AAV vectors . Cross-species complementation experiments, testing mouse GPR108 in human cells and vice versa, can further validate evolutionary conservation of this entry mechanism .
Engineering AAV vectors to modulate GPR108 dependency presents an important opportunity for improving gene therapy vectors. To bypass GPR108 dependency, researchers should focus on capsid engineering strategies targeting the VP1u region, which has been identified as the key determinant of GPR108 usage . Specific approaches include: 1) Creating chimeric vectors incorporating the VP1u region from AAV5, the only serotype that maintains transduction capability independent of GPR108 ; 2) Implementing directed evolution with selective pressure in GPR108-null cells to isolate variants with reduced dependency; 3) Conducting alanine scanning mutagenesis of the VP1u region to identify specific residues mediating GPR108 interaction that could be modified. Conversely, to enhance GPR108-mediated entry, researchers could: 1) Incorporate peptide motifs that strengthen GPR108 binding; 2) Engineer capsids to preferentially traffic through GPR108-rich compartments within the trans-Golgi network; 3) Modify vector production methods to ensure proper display of the VP1u region, which may otherwise be sequestered within the capsid. Importantly, researchers must verify that engineering efforts don't compromise other aspects of vector function through comprehensive transduction studies in multiple cell types and in vivo models .
GPR108 functions as a complex modulator of TLR signaling pathways, exhibiting both activating and suppressive effects in a context-dependent manner. Studies using GPR108-null mice demonstrate enhanced cytokine secretion and increased NF-κB and IRF3 signaling after TLR stimulation, suggesting GPR108 normally restrains these responses . Mechanistically, GPR108 interacts directly with TLR adaptor protein MyD88 and interferes with MyD88's binding to TLR4, specifically by blocking MyD88 ubiquitination . This interference reduces MyD88 expression levels and subsequently attenuates downstream signaling. Paradoxically, isolated expression of GPR108 in the absence of TLR inducers activates NF-κB signaling, while co-expression with TLRs reduces both NF-κB and IFNβ promoter activation compared to expression of either component alone . This dual functionality suggests GPR108 helps maintain immune responses within appropriate boundaries. Additionally, GPR108 is itself regulated by TIRAP (Toll/interleukin-1 receptor domain-containing adapter protein), which antagonizes GPR108 function, creating a regulatory network of checks and balances in innate immune signaling . The multi-layered interactions between GPR108 and innate immune components highlight a membrane-associated signaling complex with sophisticated regulatory capacity.
To comprehensively assess GPR108's impact on immune signaling pathways, researchers should employ multiple complementary approaches. Begin with GPR108 knockout models, using CRISPR/Cas9-generated cell lines as described in previous studies , alongside GPR108 reconstitution systems for rescue experiments. For transcriptional response analysis, implement NF-κB and IFNβ promoter reporter assays using luciferase constructs in wild-type versus GPR108-null backgrounds, with and without TLR stimulation . Quantify endogenous signaling by measuring phosphorylation of key signaling components (p65, IRF3, IKKα/β, TBK1) using phospho-specific antibodies in Western blot analysis following TLR ligand stimulation. For cytokine production assessment, use multiplexed ELISA or cytometric bead arrays to quantify TNFα, IL-6, IL-1β, and type I interferons in supernatants from stimulated cells. Protein interaction dynamics should be monitored through co-immunoprecipitation experiments examining MyD88-GPR108 and TLR4-MyD88 interactions under various stimulation conditions . To assess MyD88 ubiquitination, perform ubiquitination assays using His-tagged ubiquitin pulldowns followed by MyD88 immunoblotting. Finally, implement RT-qPCR panels to monitor expression of inflammation-associated genes in response to TLR ligands in GPR108-sufficient versus deficient systems .
Several experimental models have been validated for investigating GPR108's immunomodulatory functions across different biological contexts. For cellular studies, THP-1 monocytic cell lines with CRISPR/Cas9-mediated GPR108 deletion provide a well-characterized system for studying human innate immune responses . Primary bone marrow-derived macrophages (BMDMs) isolated from GPR108-null mice represent a physiologically relevant primary cell model that maintains the complexity of primary immune cell signaling . For in vivo inflammation models, GPR108-knockout mice enable assessment of systemic and tissue-specific inflammatory responses to various TLR ligands (LPS, Poly I:C, CpG DNA), with readouts including serum cytokine levels, immune cell infiltration, and tissue pathology . When studying the interplay between GPR108 and specific TLR pathways, reconstitution experiments in HEK293 cells (which lack most TLRs) allow controlled expression of individual TLRs with or without GPR108 co-expression . For molecular interaction studies investigating GPR108's engagement with MyD88 and TRAF6, proximity ligation assays in fixed cells or FRET/BRET approaches in live cells offer spatial and temporal resolution of protein associations. Finally, tissue-specific conditional knockout models using Cre-loxP systems can dissect the contribution of GPR108 in specific immune cell populations during inflammation.
Contradictory findings regarding GPR108 function can be systematically addressed through several approaches. First, conduct parallel experiments in multiple cell types, as GPR108's dual role in both activating NF-κB and attenuating TLR responses appears context-dependent . Second, carefully control expression levels, as forced overexpression of GPR108 can be toxic and may not reflect physiological function . Third, examine temporal dynamics, as GPR108 abundance increases upon TLR stimulation, suggesting its function may evolve throughout an immune response . Fourth, map domain-specific functions using truncation mutants to determine if different domains mediate distinct effects on signaling pathways. Fifth, comprehensively assay multiple readouts (transcription factor activation, cytokine production, pathway phosphorylation) as effects may vary across different output measures. Sixth, consider species differences, as human and mouse GPR108 may have evolved distinct regulatory mechanisms. Seventh, account for potential compensation by related proteins like GPR107 in knockout models. Finally, integrate proteomic approaches to identify the complete interactome of GPR108 under different conditions, which may reveal competing binding partners that explain context-dependent functions. Rigorous controls, including rescue experiments and domain swap approaches, are essential for distinguishing direct versus indirect effects of GPR108 on signaling pathways .
When generating GPR108 knockout models, researchers must implement several critical considerations to ensure valid experimental outcomes. For CRISPR/Cas9-mediated deletion, target multiple exons (specifically exons 1 and 13 as previously validated) to ensure complete functional ablation . Verify knockout at both genomic, transcript, and protein levels using PCR of the deletion region, RT-qPCR for mRNA expression, and Western blotting with validated antibodies, respectively . Screen multiple clones to identify those with complete biallelic deletion, as heterozygous or incomplete knockouts may retain partial function. For phenotypic validation, assess both viral transduction efficiency of AAV serotypes (except AAV5) and TLR-induced signaling responses, as GPR108 functions in both pathways . Include appropriate controls for potential off-target effects by sequencing predicted off-target sites and performing rescue experiments with wildtype GPR108 expression. When working with animal models, consider potential developmental effects of constitutive deletion and implement conditional knockout strategies if embryonic lethality is observed. Finally, characterize tissue-specific expression patterns before and after knockout to understand the breadth of systems potentially affected by GPR108 deletion .
Investigating the dual functionality of GPR108 presents several technical challenges requiring specialized approaches. First, separating overlapping functions demands carefully designed experiments, as viral infection itself triggers immune responses that may confound interpretation of GPR108's direct effects on each pathway. To address this, use replication-defective viral vectors and inactivated virions that engage entry pathways without triggering immune responses. Second, GPR108's localization to the trans-Golgi network complicates live imaging studies of dynamic interactions, requiring super-resolution microscopy techniques like STED or STORM combined with precisely-timed fixation to capture transient events . Third, the potential toxicity of GPR108 overexpression necessitates inducible expression systems with titratable promoters to achieve physiologically relevant levels . Fourth, studying interactions with membrane-bound TLRs requires specialized approaches for membrane protein preservation during immunoprecipitation, such as using crosslinking agents or detergents that maintain membrane microdomains. Fifth, GPR108's context-dependent effects on NF-κB (both activating and inhibiting) require multiple readouts across different timepoints and stimulus conditions to fully characterize its signaling impact . Finally, reconciling in vitro and in vivo findings demands comprehensive validation in primary cells from GPR108-null animals and tissue-specific conditional knockout models to understand cell type-specific functions in complex biological systems.
To identify novel therapeutic applications targeting GPR108, researchers should implement a systematic experimental framework spanning multiple disease contexts. First, for gene therapy applications, conduct comparative transduction studies with numerous AAV serotypes in GPR108-knockout versus wildtype tissues to identify optimal vector designs for specific therapeutic targets . Second, for inflammatory disorders, examine GPR108 expression levels in patient samples across various autoimmune and inflammatory conditions, correlating with disease severity markers. Third, develop small molecule screens targeting GPR108 using cell-based assays with dual readouts for viral entry and NF-κB activation to identify compounds that selectively modulate one function while preserving the other . Fourth, generate humanized mouse models expressing human GPR108 variants to validate therapeutic approaches in vivo with improved translational relevance. Fifth, implement unbiased interactome analysis using BioID or APEX proximity labeling followed by mass spectrometry to identify new GPR108-interacting proteins that might reveal unexpected disease connections. Sixth, apply CRISPR activation and interference screens in disease-relevant cell types to identify contexts where GPR108 modulation affects disease phenotypes. Finally, develop antibody-based approaches that target specific epitopes or conformations of GPR108 to selectively block viral entry without disrupting immune regulatory functions, potentially creating novel antiviral therapeutics with minimal immune dysregulation.
| Detection Method | Sensitivity | Application | Technical Considerations |
|---|---|---|---|
| Western Blot | Moderate-High | Protein expression, molecular weight verification | Use 8-10% gels; BSA blocking preferred; may detect multiple glycosylated forms |
| Immunofluorescence | High | Subcellular localization | Co-stain with TGN46; mild permeabilization; confocal imaging recommended |
| Immunohistochemistry | Moderate | Tissue expression patterns | Paraffin embedding works well; antigen retrieval required |
| RT-qPCR | Very High | mRNA expression quantification | Validate primers across species; use multiple reference genes |
| RT-MLPA | High | Multiplexed expression analysis | Allows simultaneous detection of multiple genes; requires careful probe design |
Several cutting-edge technologies hold promise for deepening our understanding of GPR108 biology. CRISPR-based screening approaches beyond knockout, such as CRISPRa and CRISPRi, could identify genes that synergize with or compensate for GPR108 in both viral entry and immune regulation pathways . Single-cell transcriptomic and proteomic analyses would reveal cell type-specific GPR108 expression patterns and response signatures, particularly in heterogeneous immune cell populations. Cryo-electron microscopy could elucidate the structural basis of GPR108-AAV capsid interactions, potentially identifying critical binding interfaces for therapeutic targeting . Optogenetic approaches coupled with live-cell imaging would enable temporal control of GPR108 function, revealing kinetic aspects of its dual functionality. CRISPR-mediated homology-directed repair could introduce specific mutations to dissect structure-function relationships in endogenous GPR108. Advanced protein-protein interaction mapping techniques such as cross-linking mass spectrometry would identify interaction domains at amino acid resolution. Finally, organoid systems derived from GPR108-modified stem cells would provide physiologically relevant 3D models for studying tissue-specific functions in development and disease contexts, bridging the gap between simplified cell culture systems and complex in vivo models.