GPR82 Antibody

Shipped with Ice Packs
In Stock

Description

Antibody Characteristics

GPR82 antibodies are polyclonal reagents rigorously validated for specificity and reproducibility. Key features include:

  • Target specificity: Recognizes human GPR82 (UniProt ID: Q96P67) with high affinity .

  • Cross-reactivity:

    SpeciesPercent Identity
    Gorilla100%
    Pig94%
    Dog94%
    Rabbit94%
    Data sourced from BLAST analysis
  • Applications: Validated for immunohistochemistry (IHC; 1:50–1:200 dilution), Western blot (WB), and immunofluorescence (ICC-IF) .

  • Immunogen: Synthetic peptide corresponding to residues AISRYATLMQKDSSQETTSCYEKIFYGHLLKKFRQPNFAR .

Phenotypic Effects of GPR82 Deficiency

Studies in GPR82-deficient mice revealed critical metabolic roles:

ParameterWild-Type (WT)GPR82 Knockout (KO)Significance
Body weightNormalReduced (-15–20%)P < 0.001
Visceral fat massStandardReduced (-30%)P < 0.01
Plasma triglycerides85 mg/dL62 mg/dLP < 0.05
Glucose toleranceNormalImprovedP < 0.01

KO mice exhibited decreased adipocyte size, increased hepatic leptin receptor expression, and reduced food intake despite lower physical activity .

Mechanistic Insights

  • Energy Homeostasis: GPR82 promotes lipid accumulation and suppresses basal metabolic rate, aligning with the "thrifty gene" hypothesis .

  • Immune Modulation: Reduced delayed-type hypersensitivity (DTH) responses suggest ancillary roles in immune regulation .

Research Applications

  • Metabolic Studies: Investigating obesity, diabetes, and lipid disorders .

  • Neurological Research: Mapping receptor expression in brain regions linked to motor activity and nociception .

  • Immunohistochemistry: Localizing GPR82 in human tissues, including adipose and neuronal samples .

Product Specs

Buffer
The antibody is provided as a liquid solution in phosphate buffered saline (PBS) containing 50% glycerol, 0.5% bovine serum albumin (BSA), and 0.02% sodium azide.
Form
Liquid
Lead Time
We typically dispatch orders within 1-3 business days of receipt. Delivery time may vary depending on the shipping method and destination. For specific delivery timeframes, please consult your local distributors.
Synonyms
GPR82; Probable G-protein coupled receptor 82
Target Names
Uniprot No.

Target Background

Function
GPR82 is an orphan receptor.
Database Links

HGNC: 4533

OMIM: 300748

KEGG: hsa:27197

STRING: 9606.ENSP00000303549

UniGene: Hs.567457

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR82 and what are its key structural features?

GPR82 (G Protein-Coupled Receptor 82) is a member of the G protein-coupled receptor superfamily. It is encoded by the GPR82 gene in humans with the UniProt ID Q96P67. The protein has a molecular weight of approximately 38.4 kDa and contains multiple transmembrane domains characteristic of GPCRs . While GPR82 is considered an orphan receptor (receptor without known endogenous ligand), recent research suggests it may function in intracellular signaling pathways. The receptor contains intracellular, transmembrane, and extracellular domains, with antibodies typically targeting the carboxyl-terminal tail or specific amino acid sequences within these regions .

How should researchers select the appropriate GPR82 antibody for their experiments?

Selection of a GPR82 antibody should be guided by experimental requirements, including:

  • Application compatibility: Verify the antibody has been validated for your intended application (WB, IHC, IF, ELISA). For example, catalog number ABIN1535750 has been validated for ELISA and Western blotting applications , while HPA035914 is recommended for immunohistochemistry at dilutions of 1:50-1:200 .

  • Epitope specificity: Different antibodies target distinct regions of GPR82. Antibodies targeting AA 121-170 are available from multiple vendors , while others target the C-terminal region . The epitope location can affect detection of different GPR82 isoforms or post-translationally modified variants.

  • Phosphorylation state detection: If studying receptor activation, consider whether phosphorylation-dependent or independent antibodies are required. Some antibodies, like the non-phospho-GPR82 receptor antibody (7TM0118N), specifically detect total GPR82 receptors independent of phosphorylation state .

  • Species reactivity: Most available antibodies react with human GPR82, with many also cross-reacting with mouse GPR82 . For comparative studies across species, select antibodies with validated cross-reactivity.

What are the common challenges in validating GPR82 antibody specificity?

Validation of GPR82 antibody specificity presents several challenges:

  • Low endogenous expression: GPR82 may have limited expression in commonly used cell lines, making it difficult to verify antibody specificity against endogenous protein. A recommended approach is using transfected cell lines (e.g., HEK293) overexpressing GPR82 compared to mock-transfected controls .

  • Cross-reactivity with related GPCRs: The GPCR superfamily has structural similarities, requiring stringent validation to ensure antibodies don't cross-react with related receptors. Antigen affinity chromatography purification helps minimize this issue .

  • Isoform specificity: Multiple isoforms or splice variants of GPR82 may exist, and antibodies may not detect all variants equally. Western blotting with positive and negative controls helps identify which isoforms are recognized .

  • Background signal: Particularly in IHC applications, non-specific binding can complicate interpretation. Proper blocking and antibody dilution optimization are essential for reducing background signal.

What are the optimal conditions for Western blot detection of GPR82?

For optimal Western blot detection of GPR82, researchers should follow these methodological guidelines:

  • Sample preparation: GPR82 is a membrane protein, requiring appropriate lysis buffers containing detergents (e.g., Triton X-100, NP-40, or CHAPS) to effectively solubilize the receptor from cell membranes.

  • Antibody dilutions: Starting dilutions of 1:500 to 1:2000 are recommended for most GPR82 antibodies in Western blotting applications . The exact dilution should be empirically determined for each antibody and experimental system.

  • Controls: Include both positive controls (cells overexpressing GPR82) and negative controls (mock-transfected cells) to confirm antibody specificity. HEK293 cells stably expressing GPR82 have been successfully used as positive controls .

  • Detection systems: Secondary antibody detection systems should be optimized based on the expected abundance of GPR82 in samples. Enhanced chemiluminescence (ECL) systems are suitable for most applications, with more sensitive detection methods recommended for low-abundance samples.

  • Band interpretation: GPR82 typically appears around 38-40 kDa, though post-translational modifications like glycosylation may result in higher apparent molecular weights .

How can immunohistochemistry protocols be optimized for GPR82 detection in tissue samples?

Optimizing IHC protocols for GPR82 detection requires attention to several methodological factors:

  • Tissue preparation: Both formalin-fixed paraffin-embedded (FFPE) and frozen sections can be used, though epitope accessibility may differ. Antigen retrieval methods (heat-induced or enzymatic) should be optimized for FFPE samples to expose GPR82 epitopes.

  • Antibody dilutions: For IHC applications, GPR82 antibodies are typically used at dilutions between 1:50 and 1:200 . Titration experiments should be performed to determine optimal concentrations that maximize specific signal while minimizing background.

  • Detection systems: Polymer-based detection systems often provide superior signal-to-noise ratios compared to avidin-biotin methods for GPR82 detection in tissues.

  • Blocking conditions: Thorough blocking with appropriate sera (matching the species of the secondary antibody) containing 1-5% BSA helps reduce non-specific binding in IHC applications.

  • Controls: Include positive control tissues known to express GPR82 and negative controls (primary antibody omission and isotype controls) to confirm staining specificity.

What approaches are recommended for determining GPR82 subcellular localization?

To accurately determine GPR82 subcellular localization, researchers should consider:

  • Immunofluorescence techniques: Co-staining with established subcellular markers (e.g., Na+/K+ ATPase for plasma membrane, calnexin for ER, GM130 for Golgi) helps precisely locate GPR82 within cellular compartments.

  • Confocal microscopy: High-resolution confocal imaging enables detailed visualization of GPR82 localization patterns, particularly important for membrane proteins that may show distinct distribution patterns.

  • Fractionation approaches: Complementing imaging with biochemical subcellular fractionation and subsequent Western blotting can provide quantitative data on GPR82 distribution among different cellular compartments.

  • Live-cell imaging: For dynamic studies, consider using epitope-tagged GPR82 constructs (ensuring tags don't interfere with trafficking) combined with live-cell imaging to monitor receptor internalization and recycling in response to stimuli.

How can GPR82 function be studied in relation to tumor microenvironment and immune responses?

Recent research implicates G protein-coupled receptors in tumor microenvironment (TME) regulation, with GPR182 (a related receptor) shown to limit antitumor immunity via chemokine scavenging . To investigate potential similar functions for GPR82:

  • Co-immunoprecipitation studies: Use GPR82 antibodies to identify binding partners within the TME, potentially revealing interactions with chemokines or cytokines. The non-phospho-GPR82 antibody has been validated for isolation and enrichment of GPR82 receptors from tissue lysates .

  • Chemokine scavenging assays: Adapt methodologies used in GPR182 studies to determine if GPR82 acts as an atypical chemokine receptor (ACKR). This involves measuring uptake and degradation of fluorescently labeled chemokines in cells expressing GPR82 versus controls.

  • T-cell infiltration analysis: In animal models, compare T-cell infiltration patterns in tumors between GPR82-deficient and wild-type animals, similar to approaches used for GPR182 . Immunohistochemistry with T-cell markers can quantify differences in immune cell recruitment.

  • Receptor expression in tumor-associated cells: Use validated GPR82 antibodies to analyze expression patterns across different cell types within the TME, with particular attention to endothelial cells and immune cell populations.

What approaches are effective for determining GPR82 signaling pathways?

To elucidate GPR82 signaling pathways, researchers should consider these methodological approaches:

  • G-protein coupling assays: Determine which G-protein subtypes couple to GPR82 using approaches such as [35S]GTPγS binding assays or BRET-based biosensors that detect G-protein activation in live cells.

  • Second messenger analysis: Measure changes in canonical second messengers (cAMP, Ca2+, inositol phosphates) in response to GPR82 activation or inhibition to identify downstream signaling pathways.

  • Phosphorylation site mapping: Use phospho-specific antibodies or mass spectrometry to identify GPR82 phosphorylation sites that may regulate receptor function and signaling.

  • Interactome analysis: Combine co-immunoprecipitation with mass spectrometry to identify the complete set of GPR82 interacting proteins, providing insights into non-canonical signaling mechanisms.

  • Transcriptomic profiling: Compare gene expression profiles between wild-type cells and those with GPR82 knockdown/knockout to identify downstream transcriptional effects of GPR82 signaling.

What techniques are most reliable for quantifying GPR82 expression levels across different tissues and experimental conditions?

For accurate quantification of GPR82 expression levels:

  • qRT-PCR: Design primers specific to GPR82 mRNA, with attention to potential splice variants. Validate primer specificity and efficiency using standard curves.

  • Western blotting with calibrated standards: Include recombinant GPR82 protein standards of known concentrations to create calibration curves for quantitative Western blotting.

  • Flow cytometry: For cell surface expression quantification, optimize staining protocols using GPR82 antibodies that recognize extracellular epitopes, with careful attention to controls.

  • Mass spectrometry: For absolute quantification, targeted proteomic approaches using isotope-labeled peptide standards corresponding to unique GPR82 peptides provide highly accurate measurements.

  • Tissue microarrays: For comparative analysis across multiple tissue samples, standardized IHC on tissue microarrays with automated image analysis allows semi-quantitative comparison of GPR82 expression patterns.

How should researchers address inconsistent Western blot results when detecting GPR82?

When encountering inconsistent Western blot results for GPR82 detection:

  • Sample preparation optimization: Membrane proteins require special consideration. Test different lysis buffers with varying detergent compositions to ensure complete solubilization of GPR82. Avoid excessive heating of samples which may cause aggregation of membrane proteins.

  • Reduction and denaturation conditions: Test different reducing agent concentrations and denaturation temperatures. Some epitopes may be masked under standard reducing conditions or may require specific denaturation parameters.

  • Transfer conditions: Optimize transfer parameters for high molecular weight membrane proteins. Consider using lower methanol concentrations in transfer buffer and longer transfer times or semi-dry transfer systems for improved efficiency.

  • Blocking optimization: Test different blocking agents (BSA vs. milk) as milk proteins may contain phosphorylated proteins that interfere with phospho-specific antibody detection.

  • Antibody validation: Confirm antibody specificity using positive controls (overexpression systems) and negative controls (knockdown/knockout samples). Consider testing multiple antibodies targeting different epitopes of GPR82.

What are the key considerations when interpreting immunohistochemical staining patterns of GPR82 across different tissues?

When interpreting GPR82 immunohistochemical staining patterns:

  • Staining localization: GPR82, as a membrane protein, should primarily localize to cellular membranes. Unexpected cytoplasmic or nuclear staining may indicate non-specific binding or cellular processing of the receptor.

  • Differential expression patterns: Compare staining intensity and distribution across different cell types within the same tissue. Note whether expression is uniform or heterogeneous across similar cell populations.

  • Correlation with function: Interpret expression patterns in the context of known or hypothesized functions. For instance, if investigating potential roles in immune regulation, pay particular attention to expression in immune cell-rich regions.

  • Pathological alterations: When comparing normal versus diseased tissues, document changes in both expression levels and subcellular localization patterns, as both may be functionally relevant.

  • Technical artifacts: Distinguish true signal from edge effects, uneven staining, or other technical artifacts by examining multiple samples and sections with appropriate controls.

How can researchers distinguish between specific and non-specific binding when using GPR82 antibodies in immunoprecipitation experiments?

To distinguish between specific and non-specific binding in GPR82 immunoprecipitation:

  • Pre-clearing samples: Pre-clear lysates with protein A/G beads alone to remove proteins that bind non-specifically to the beads.

  • Isotype controls: Include matched isotype control antibodies from the same species as the GPR82 antibody to identify proteins that bind non-specifically to immunoglobulins.

  • Competing peptide controls: Pre-incubate GPR82 antibody with the immunizing peptide to block specific binding sites. Proteins that appear in standard IP but not in peptide-blocked controls are likely specific interactors.

  • Reciprocal co-immunoprecipitation: Confirm interactions by performing reverse co-IP using antibodies against suspected binding partners to pull down GPR82.

  • Stringency optimization: Test different wash buffer compositions with varying salt and detergent concentrations to identify conditions that maintain specific interactions while reducing non-specific binding.

What are the most promising approaches for identifying potential ligands for the orphan receptor GPR82?

As GPR82 remains an orphan receptor, these methodological approaches show promise for ligand identification:

  • Unbiased screening approaches: Utilize techniques such as differential screening of tissue extracts, bioactive lipid libraries, or peptide libraries against cells expressing GPR82 coupled to sensitive readout systems (calcium flux, β-arrestin recruitment, or receptor internalization).

  • Computational prediction: Apply in silico approaches including molecular docking, pharmacophore modeling, and machine learning algorithms trained on known GPCR-ligand pairs to predict potential GPR82 ligands for subsequent experimental validation.

  • Proximity-based labeling: Implement BioID or APEX2 proximity labeling techniques with GPR82 as the bait protein to identify proteins that interact with GPR82 in its native cellular environment, potentially including endogenous ligands.

  • Reverse pharmacology: Perform detailed phenotypic analysis of GPR82 knockout models to identify physiological processes affected by receptor absence, providing clues to potential signaling pathways and ligand classes.

  • Transcriptional profiling: Compare transcriptional responses to receptor overexpression or knockout across multiple cell types to identify common gene expression signatures that may point to specific signaling pathways and potential ligands.

How can CRISPR/Cas9 genome editing be effectively applied to study GPR82 function?

CRISPR/Cas9 genome editing offers powerful approaches for investigating GPR82 function:

  • Complete knockout models: Design guide RNAs targeting critical exons of GPR82 to generate complete loss-of-function models in cell lines or animal models. Validate knockout efficiency using GPR82 antibodies .

  • Knock-in of reporter tags: Insert fluorescent protein tags or epitope tags at the endogenous GPR82 locus to visualize receptor expression and trafficking without artifacts from overexpression systems.

  • Domain-specific mutations: Introduce point mutations in specific functional domains (e.g., G-protein coupling domains, potential phosphorylation sites) to dissect structure-function relationships without completely eliminating expression.

  • Conditional knockout systems: Implement inducible or tissue-specific CRISPR systems to study GPR82 function in specific contexts or developmental stages while avoiding compensatory adaptations from constitutive knockout.

  • CRISPRi/CRISPRa approaches: Use CRISPR interference or activation to modulate GPR82 expression levels without permanently altering the genome, allowing for dose-dependent studies of receptor function.

What role might GPR82 play in regulating immune responses based on recent findings with related receptors?

Building on findings that GPR182 functions as an atypical chemokine receptor to limit T cell infiltration in tumors , potential immunoregulatory roles for GPR82 could be investigated through:

  • Immunophenotyping: Compare immune cell populations in tissues of wild-type versus GPR82-deficient animals using flow cytometry and GPR82 antibodies to identify differences in immune cell distribution or activation states.

  • Chemokine binding and scavenging assays: Test whether GPR82, like GPR182, can bind and internalize chemokines using fluorescently labeled chemokines and cells expressing GPR82. Measure intracellular accumulation and degradation rates to assess scavenging function.

  • T cell migration assays: Compare chemotactic responses of T cells toward conditioned media from wild-type versus GPR82-deficient cells to determine if GPR82 expression affects chemokine gradient formation.

  • Cancer models: Evaluate tumor growth and immune infiltration in GPR82-deficient versus wild-type animals, with particular attention to T cell infiltration patterns and response to immune checkpoint inhibitors.

  • Autoimmunity models: Test whether GPR82 deficiency affects the development or progression of autoimmune diseases in relevant animal models, which could indicate a role in immune tolerance or inflammation regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.