GPRIN2 antibody is an immunological reagent developed to detect and study the G Protein Regulated Inducer of Neurite Outgrowth 2 (GPRIN2) protein in various biological samples. GPRIN2, also known as GRIN2 or KIAA0514, is a protein that may be involved in neurite outgrowth processes in neural development . These antibodies serve as valuable tools for researchers investigating neural development, neurological disorders, and related pathological conditions by enabling the detection, localization, and characterization of GPRIN2 protein expression .
GPRIN2 antibodies are produced by immunizing host animals, typically rabbits, with specific GPRIN2 protein fragments or synthetic peptides derived from the human GPRIN2 sequence. The resulting antibodies can recognize and bind to GPRIN2 protein in experimental settings, allowing for its detection through various immunological techniques .
GPRIN2 antibodies are available in several forms, each with specific characteristics suitable for different research applications:
The majority of commercially available GPRIN2 antibodies are produced in rabbits, though some mouse-derived variants exist. Rabbit polyclonal antibodies against GPRIN2 are widely used due to their high sensitivity and broad epitope recognition capabilities .
GPRIN2 antibodies are predominantly available as polyclonal antibodies, which are produced by multiple B cell lineages and recognize multiple epitopes on the GPRIN2 protein. This provides robust detection but may introduce some variability between batches .
GPRIN2 antibodies are often designed to target specific regions of the protein:
N-terminal targeting antibodies: These recognize epitopes in the amino-terminal region of GPRIN2
Middle region antibodies: These target central portions of the protein
Full-length antibodies: These are raised against recombinant full-length GPRIN2 protein
The specificity of GPRIN2 antibodies is determined by the immunogen used for their production:
| Catalog Number | Immunogen |
|---|---|
| ABIN7184454 | Synthesized peptide derived from N-terminal of Human GPRIN2 |
| HPA070760 | NVSTMGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLA |
| A37126 | Synthesized peptide derived from N-terminal of human GPRIN2 |
GPRIN2 antibodies serve multiple research purposes through various immunological techniques:
GPRIN2 antibodies are frequently used in Western blotting to detect and quantify GPRIN2 protein in tissue or cell lysates. This technique allows researchers to determine the molecular weight and expression levels of GPRIN2 across different samples . Validated examples include antibodies ABIN7184454 and A37126, which have demonstrated specificity in detecting GPRIN2 in human samples through Western blot analysis .
| Antibody | Recommended Dilution | Sample Types | Validation |
|---|---|---|---|
| ABIN7184454 | Not specified | HuvEc cells, K562 cells, HepG2 cells | Validated |
| A37126 | Not specified | Human samples | Validated with HuvEc, K562, HepG2 cells |
For tissue localization studies, GPRIN2 antibodies enable the visualization of GPRIN2 distribution in tissue sections. This application helps researchers study expression patterns across different cell types and anatomical locations . For instance, antibody A37126 has been validated for immunohistochemical analysis of human brain tissue, providing insights into GPRIN2's neural expression patterns .
GPRIN2 antibodies optimized for immunofluorescence allow for subcellular localization studies and co-localization with other proteins of interest. Antibodies such as HPA070760 and NBP3-17378 are specifically designed for immunofluorescence applications with recommended concentrations between 0.25-2 μg/mL .
Several GPRIN2 antibodies, including ABIN7184454, are suitable for ELISA applications, enabling quantitative detection of GPRIN2 in biological samples .
Research utilizing GPRIN2 antibodies has contributed to understanding this protein's biological roles:
GPRIN2 is believed to be involved in neurite outgrowth processes, potentially through interactions with G proteins that regulate neuronal development. The protein is primarily expressed in neural tissues, suggesting a specialized role in neuronal function .
Studies have linked GPRIN2 to several conditions:
Bladder Squamous Cell Carcinoma: GPRIN2 alterations have been implicated in this cancer type
Benign Epilepsy With Centrotemporal Spikes: Genetic studies have associated GPRIN2 with this neurological condition
Rare damaging mutations in GPRIN2 have been identified through whole exome sequencing studies
GPRIN2 antibodies have enabled various research directions:
The role of GPRIN2 in neurite outgrowth makes these antibodies valuable for investigating neural development processes. Immunological detection of GPRIN2 in developing neural tissues can provide insights into the temporal and spatial regulation of neurite extension .
GPRIN2 antibodies are being utilized to examine expression patterns in various cancer types, with potential implications for diagnosis and targeted therapies. The association with bladder squamous cell carcinoma suggests possible oncogenic roles that warrant further investigation .
The identification of rare damaging mutations in GPRIN2 highlights the importance of these antibodies in validating genetic findings and understanding their functional consequences . GPRIN2 antibodies can help correlate genotypic variations with protein expression and localization abnormalities.
To contextualize GPRIN2 antibodies within the broader research landscape, it's useful to compare them with antibodies targeting related proteins:
| Target Protein | Relationship to GPRIN2 | Key Differences in Antibody Applications |
|---|---|---|
| GPRIN1 | Paralog | Different tissue expression patterns; different antibody validation requirements |
| GPRIN3 | Paralog | Less well-characterized; antibodies less widely available |
| G-protein antibodies | Interacting partners | Often used in co-immunoprecipitation with GPRIN2 antibodies |