GPRIN2 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to GPRIN2 Antibody

GPRIN2 antibody is an immunological reagent developed to detect and study the G Protein Regulated Inducer of Neurite Outgrowth 2 (GPRIN2) protein in various biological samples. GPRIN2, also known as GRIN2 or KIAA0514, is a protein that may be involved in neurite outgrowth processes in neural development . These antibodies serve as valuable tools for researchers investigating neural development, neurological disorders, and related pathological conditions by enabling the detection, localization, and characterization of GPRIN2 protein expression .

GPRIN2 antibodies are produced by immunizing host animals, typically rabbits, with specific GPRIN2 protein fragments or synthetic peptides derived from the human GPRIN2 sequence. The resulting antibodies can recognize and bind to GPRIN2 protein in experimental settings, allowing for its detection through various immunological techniques .

Types and Classifications of GPRIN2 Antibodies

GPRIN2 antibodies are available in several forms, each with specific characteristics suitable for different research applications:

Classification by Host Species

The majority of commercially available GPRIN2 antibodies are produced in rabbits, though some mouse-derived variants exist. Rabbit polyclonal antibodies against GPRIN2 are widely used due to their high sensitivity and broad epitope recognition capabilities .

Classification by Clonality

GPRIN2 antibodies are predominantly available as polyclonal antibodies, which are produced by multiple B cell lineages and recognize multiple epitopes on the GPRIN2 protein. This provides robust detection but may introduce some variability between batches .

Classification by Target Region

GPRIN2 antibodies are often designed to target specific regions of the protein:

  • N-terminal targeting antibodies: These recognize epitopes in the amino-terminal region of GPRIN2

  • Middle region antibodies: These target central portions of the protein

  • Full-length antibodies: These are raised against recombinant full-length GPRIN2 protein

Immunogen Information

The specificity of GPRIN2 antibodies is determined by the immunogen used for their production:

Catalog NumberImmunogen
ABIN7184454Synthesized peptide derived from N-terminal of Human GPRIN2
HPA070760NVSTMGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLA
A37126Synthesized peptide derived from N-terminal of human GPRIN2

Applications of GPRIN2 Antibodies in Research

GPRIN2 antibodies serve multiple research purposes through various immunological techniques:

Western Blotting (WB)

GPRIN2 antibodies are frequently used in Western blotting to detect and quantify GPRIN2 protein in tissue or cell lysates. This technique allows researchers to determine the molecular weight and expression levels of GPRIN2 across different samples . Validated examples include antibodies ABIN7184454 and A37126, which have demonstrated specificity in detecting GPRIN2 in human samples through Western blot analysis .

AntibodyRecommended DilutionSample TypesValidation
ABIN7184454Not specifiedHuvEc cells, K562 cells, HepG2 cellsValidated
A37126Not specifiedHuman samplesValidated with HuvEc, K562, HepG2 cells

Immunohistochemistry (IHC)

For tissue localization studies, GPRIN2 antibodies enable the visualization of GPRIN2 distribution in tissue sections. This application helps researchers study expression patterns across different cell types and anatomical locations . For instance, antibody A37126 has been validated for immunohistochemical analysis of human brain tissue, providing insights into GPRIN2's neural expression patterns .

Immunofluorescence (IF)

GPRIN2 antibodies optimized for immunofluorescence allow for subcellular localization studies and co-localization with other proteins of interest. Antibodies such as HPA070760 and NBP3-17378 are specifically designed for immunofluorescence applications with recommended concentrations between 0.25-2 μg/mL .

Enzyme-Linked Immunosorbent Assay (ELISA)

Several GPRIN2 antibodies, including ABIN7184454, are suitable for ELISA applications, enabling quantitative detection of GPRIN2 in biological samples .

GPRIN2 Function and Associated Conditions

Research utilizing GPRIN2 antibodies has contributed to understanding this protein's biological roles:

Physiological Function

GPRIN2 is believed to be involved in neurite outgrowth processes, potentially through interactions with G proteins that regulate neuronal development. The protein is primarily expressed in neural tissues, suggesting a specialized role in neuronal function .

Associated Medical Conditions

Studies have linked GPRIN2 to several conditions:

  • Bladder Squamous Cell Carcinoma: GPRIN2 alterations have been implicated in this cancer type

  • Benign Epilepsy With Centrotemporal Spikes: Genetic studies have associated GPRIN2 with this neurological condition

  • Rare damaging mutations in GPRIN2 have been identified through whole exome sequencing studies

Research Applications and Future Directions

GPRIN2 antibodies have enabled various research directions:

Neuronal Development Studies

The role of GPRIN2 in neurite outgrowth makes these antibodies valuable for investigating neural development processes. Immunological detection of GPRIN2 in developing neural tissues can provide insights into the temporal and spatial regulation of neurite extension .

Cancer Research

GPRIN2 antibodies are being utilized to examine expression patterns in various cancer types, with potential implications for diagnosis and targeted therapies. The association with bladder squamous cell carcinoma suggests possible oncogenic roles that warrant further investigation .

Genetic and Functional Studies

The identification of rare damaging mutations in GPRIN2 highlights the importance of these antibodies in validating genetic findings and understanding their functional consequences . GPRIN2 antibodies can help correlate genotypic variations with protein expression and localization abnormalities.

Comparative Analysis with Related Antibodies

To contextualize GPRIN2 antibodies within the broader research landscape, it's useful to compare them with antibodies targeting related proteins:

Target ProteinRelationship to GPRIN2Key Differences in Antibody Applications
GPRIN1ParalogDifferent tissue expression patterns; different antibody validation requirements
GPRIN3ParalogLess well-characterized; antibodies less widely available
G-protein antibodiesInteracting partnersOften used in co-immunoprecipitation with GPRIN2 antibodies

Product Specs

Buffer
The antibody is provided as a liquid solution in phosphate-buffered saline (PBS) containing 50% glycerol, 0.5% bovine serum albumin (BSA), and 0.02% sodium azide.
Form
Liquid
Lead Time
Typically, we can ship the products within 1-3 business days after receiving your order. Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Synonyms
GPRIN2 antibody; KIAA0514G protein-regulated inducer of neurite outgrowth 2 antibody; GRIN2 antibody
Target Names
GPRIN2
Uniprot No.

Target Background

Function
GPRIN2 antibody may play a role in neurite outgrowth.
Database Links

HGNC: 23730

OMIM: 611240

KEGG: hsa:9721

STRING: 9606.ENSP00000363433

UniGene: Hs.523375

Tissue Specificity
Expressed specifically in the cerebellum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.