anti-Homo sapiens (Human) GRAMD1B Antibody raised in Rabbit

Description

Definition and Basic Properties

GRAMD1B antibodies are polyclonal or monoclonal reagents targeting the GRAMD1B protein, encoded by the GRAMD1B gene (NCBI Gene ID: 57476). Key features include:

Property	Detail
Immunogen	Recombinant GRAMD1B fusion protein (e.g., residues RFKMRRMKNVQEQSLEAGLARDLPAVLAPGKEFLQLPSIEITPSSDEDTPWSNCSTPSASPRRKRFLLRKWLRVRERKECSESSSSLRI)
Host Species	Rabbit (common source for polyclonal antibodies)
Reactivity	Human, mouse (validated via Western blot, IHC, immunofluorescence)
Molecular Weight	~85 kDa (observed); 86.5 kDa (calculated)
Isoforms	Four validated isoforms (694–745 amino acids) with truncated N-/C-terminal regions

Key Domains

GRAM Domain (aa 100–194): Binds phosphatidylserine and regulates cholesterol sensing .
VASt Domain (aa 348–491): Mediates sterol/cholesterol binding .
Transmembrane Region (aa 706–726): Anchors GRAMD1B to the endoplasmic reticulum .

Post-Translational Features

Phosphorylation and SUMOylation modify its function in cholesterol transport .
Disulfide bonds (Cys⁶⁰²–Cys⁶³⁹, Cys⁶⁴³–Cys⁶⁶⁰) stabilize tertiary structure .

Research Applications

GRAMD1B antibodies are utilized in diverse experimental workflows:

Application	Protocol	Key Findings
Western Blot (WB)	Detects ~85 kDa band in human/mouse lysates	Validates GRAMD1B overexpression in adrenal tumors
Immunohistochemistry (IHC)	Staining reveals nuclear GRAMD1B accumulation in aggressive gastric cancers	Correlates high nuclear GRAMD1B with poor prognosis (lymph node metastasis)
Immunofluorescence (IF)	Localizes GRAMD1B to ER-plasma membrane contact sites in cholesterol-rich conditions	Demonstrates GRAMD1B-mediated cholesterol transport in melanoma

Cancer Biology

Breast Cancer: GRAMD1B knockdown enhances cell migration via Rho GTPase upregulation (Rac1, RhoA, Cdc42) and Akt/JAK-STAT activation . Antibodies confirmed elevated p-Akt levels in Gramd1b-silenced cells .
Melanoma: GRAMD1B loss accelerates metastasis in vivo by dysregulating cholesterol transport and activating AP-1 transcriptional programs .
Gastric Cancer: Nuclear GRAMD1B correlates with tumor grade (P = 0.026) and lymph node involvement (P = 0.005) .

Lipid Metabolism

GRAMD1B antibodies identified cholesterol accumulation in Gramd1b-depleted melanoma cells, linking sterol homeostasis to invasive phenotypes .

Clinical Relevance

Condition	Association
Neurodevelopmental Disorders	Mutations linked to intellectual disability and schizophrenia
Non-Alcoholic Steatohepatitis (NASH)	GRAMD1B/C co-suppression reduces hepatic lipid accumulation in mice
Chronic Lymphocytic Leukemia	SNPs near GRAMD1B rank as second-strongest risk alleles

Limitations and Considerations

Cross-Reactivity: Potential reactivity with paralogs GRAMD1A (46.6% sequence identity) .
Phosphorylation States: Post-translational modifications may alter observed molecular weight (90–110 kDa) .

Product Specs

Buffer

Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4

Form

Liquid

Lead Time

Typically, we can ship products within 1-3 business days after receiving your order. Delivery timelines may vary depending on the purchase method or location. Please consult your local distributor for specific delivery details.

Synonyms

GRAMD1B; KIAA1201; UNQ3032/PRO9834; Protein Aster-B; GRAM domain-containing protein 1B

Target Names

GRAMD1B

Uniprot No.

Q3KR37

Target Background

Function

GRAMD1B Antibody targets GRAMD1B, a cholesterol transporter responsible for non-vesicular cholesterol transfer from the plasma membrane (PM) to the endoplasmic reticulum (ER). GRAMD1B possesses unique domains for cholesterol and PM binding, acting as a molecular bridge facilitating cholesterol movement between these membranes. It plays a vital role in maintaining cholesterol homeostasis within the adrenal gland, exhibiting a unique ability to localize to the PM based on membrane cholesterol levels. In lipid-deficient conditions, GRAMD1B localizes to the ER membrane. However, in response to excess cholesterol in the PM, it is recruited to the endoplasmic reticulum-plasma membrane contact sites (EPCS) via its GRAM domain. At the EPCS, the sterol-binding VASt/ASTER domain binds to cholesterol within the PM, facilitating its transfer from the PM to the ER.

Database Links

HGNC: 29214

KEGG: hsa:57476

STRING: 9606.ENSP00000436500

UniGene: Hs.144725

Subcellular Location

Endoplasmic reticulum membrane; Single-pass membrane protein. Cell membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

GRAMD1B Antibody