MSRB3 is a zinc-dependent enzyme that reduces methionine sulfoxide back to methionine, mitigating oxidative stress. Antibodies against MSRB3 enable its detection in research models, aiding studies on protein repair mechanisms and disease pathways.
MSRB3 antibodies are generated using immunogens such as:
Peptide sequence: QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC .
Recombinant proteins: Fragments spanning amino acids 1–185 or 33–192 of human MSRB3 .
Epitope mapping studies indicate that most antibodies target the N-terminal region (AA 1–185), which is critical for enzymatic activity .
Western Blotting (WB): Used to detect MSRB3 in human, mouse, and rat tissues, with validation in cell lysates .
Immunofluorescence (IF): Localizes MSRB3 to mitochondria and endoplasmic reticulum in cultured cells .
Immunohistochemistry (IHC): Identifies MSRB3 overexpression in cancer tissues, correlating with oxidative stress markers .
Commercial MSRB3 antibodies undergo rigorous validation:
Specificity: Tested against protein arrays of 364 human recombinant proteins to ensure no cross-reactivity .
Reproducibility: Verified in IHC using tissue microarrays of 44 normal and 20 cancerous human tissues .
Functional assays: Antibodies like ABIN7264063 show >90% purity via SDS-PAGE .
Cancer: Elevated MSRB3 levels are linked to chemotherapy resistance in multiple myeloma, with antibodies used to quantify expression in clinical samples .
Neurology: MSRB3 knockdown models (using siRNA) exhibit increased neuronal apoptosis, validated via antibody-based assays .
KEGG: sce:YNL293W
STRING: 4932.YNL293W
MSRB3 (Methionine Sulfoxide Reductase B3) is an enzyme that catalyzes the reduction of methionine-R-sulfoxide to methionine, playing a crucial role in protein repair mechanisms and cellular protection against oxidative stress. In yeast, the homolog Msb3 functions as a GTPase-activating protein (GAP) for Rab GTPases such as Vps21, influencing membrane trafficking and cellular polarity . Research on MSRB3 contributes to our understanding of cellular redox homeostasis, protein quality control, and membrane trafficking pathways, making it relevant across multiple fields including neuroscience, aging research, and cell biology.
Current research-grade MSRB3 antibodies include both polyclonal and monoclonal variants with different specificities and applications. Polyclonal antibodies targeting amino acids 1-185 or 33-192 of the MSRB3 protein are commonly available from rabbit hosts . Monoclonal antibodies, including specific clones like 2A2 and 6F9, offer more targeted recognition . These antibodies vary in their reactivity profiles (human, mouse, rat) and are optimized for different applications including Western Blotting (WB), ELISA, Immunohistochemistry (IHC), and Immunofluorescence (IF) .
Selection should be based on a systematic evaluation of several parameters:
Target species compatibility: Confirm reactivity with your experimental model (human, mouse, rat)
Application requirements: Choose antibodies validated for your specific technique (WB, ELISA, IHC, IF)
Epitope recognition: Consider whether you need antibodies targeting specific regions (e.g., AA 1-185 vs. AA 33-192)
Clonality considerations:
Conjugation needs: Determine whether unconjugated or conjugated antibodies are required based on detection systems
For Western Blotting applications with MSRB3 antibodies, the following protocol optimizations are recommended:
Sample preparation:
Use RIPA or NP-40 based lysis buffers with protease inhibitors
Include reducing agents (DTT/β-mercaptoethanol) in sample buffer
Dilution ranges:
Blocking conditions:
5% non-fat dry milk or BSA in TBST for 1 hour at room temperature
For phospho-specific detection, BSA is preferred over milk
Incubation parameters:
Primary antibody: Overnight at 4°C with gentle agitation
Secondary antibody: 1 hour at room temperature
Expected molecular weight: Confirm band detection at approximately 21 kDa (MSRB3 isoform A) or 18 kDa (MSRB3 isoform B)
Effective IHC protocols for MSRB3 detection require:
Tissue preparation:
Formalin-fixed paraffin-embedded (FFPE) sections: 5 μm thickness
Fresh frozen sections: 8-10 μm thickness
Antigen retrieval:
Heat-mediated: Citrate buffer (pH 6.0) for 20 minutes
For challenging tissues: Try EDTA buffer (pH 9.0)
Antibody dilution:
Signal enhancement strategies:
Consider biotin-streptavidin amplification systems
Tyramide signal amplification for low-abundance targets
Controls:
Positive control: Tissues with known MSRB3 expression
Negative control: Isotype control or pre-immune serum
Absorption control: Primary antibody pre-incubated with immunizing peptide
A comprehensive validation approach should include:
Western blot analysis:
Test against recombinant MSRB3 protein as positive control
Compare expression in multiple cell lines with known MSRB3 expression levels
Include MSRB3 knockout/knockdown samples as negative controls
Cross-reactivity assessment:
Test against closely related family members (MSRB1, MSRB2)
Evaluate across multiple species if working with diverse models
Application-specific validation:
For WB: Optimize sample preparation, blocking conditions, antibody dilutions
For IHC/IF: Compare staining patterns with published data
For ELISA: Generate standard curves with recombinant protein
Epitope verification:
MSRB3 exists in multiple isoforms, requiring careful consideration for isoform-specific detection:
Isoform characteristics:
MSRB3A: Contains mitochondrial targeting sequence
MSRB3B: Contains endoplasmic reticulum targeting sequence
Antibody selection strategy:
For isoform-specific detection: Choose antibodies targeting unique N-terminal regions
For pan-MSRB3 detection: Select antibodies against common C-terminal regions
Experimental verification methods:
Western blot analysis with recombinant isoform standards
Subcellular fractionation combined with immunoblotting
Immunofluorescence co-localization with organelle markers
Data interpretation:
MSRB3A appears at approximately 21 kDa
MSRB3B appears at approximately 18 kDa
Consider potential post-translational modifications affecting mobility
When facing variable MSRB3 detection across cell types:
Expression level variations:
Quantify baseline MSRB3 expression through qRT-PCR
Consider cell-type specific regulation affecting protein abundance
Protein extraction optimization:
For membrane-associated MSRB3: Use detergent solubilization (Triton X-100, NP-40)
For cytosolic fractions: Use gentler lysis buffers
Include phosphatase inhibitors to preserve post-translational modifications
Antibody compatibility assessment:
Test multiple antibodies targeting different epitopes
Evaluate whether specific cell types might express variant forms
Signal enhancement strategies:
For low-abundance detection: Consider enrichment through immunoprecipitation
Implement signal amplification systems for IHC/IF applications
Cross-validation approach:
Combine protein detection with mRNA analysis
Utilize overexpression and knockdown controls in challenging cell types
Based on the homology to yeast Msb3, which functions as a GAP for Rab GTPases , researchers can investigate MSRB3's role in membrane trafficking through:
Co-immunoprecipitation studies:
Utilize MSRB3 antibodies to pull down protein complexes
Analyze interactions with suspected Rab GTPases and effector proteins
Quantify interactions under different cellular conditions
Subcellular localization mapping:
Employ cell fractionation followed by Western blotting
Perform immunofluorescence co-localization with endosomal markers
Consider super-resolution microscopy for detailed localization analysis
Functional assays:
Dynamic interaction studies:
Implement proximity ligation assays to detect transient interactions
Perform FRET/BRET analysis with tagged MSRB3 and suspected partners
MSRB3 exhibits distinct characteristics compared to other MSR family members:
Substrate specificity:
MSRB3 specifically reduces methionine-R-sulfoxides
MSRA reduces methionine-S-sulfoxides
This stereospecificity is critical for comprehensive protein repair
Subcellular localization:
MSRB3A: Primarily mitochondrial
MSRB3B: Endoplasmic reticulum
MSRB1: Cytosolic and nuclear
MSRB2: Mitochondrial
Catalytic mechanism:
MSRB3 utilizes specific active site residues for catalysis
Different cofactor requirements compared to other family members
Physiological roles:
MSRB3 may have specialized functions in specific tissues
Evidence suggests roles in hearing development and cardiac function
Based on the yeast Msb3 studies , researchers can investigate potential GAP activity through:
In vitro GAP assays:
Cellular GTPase activity measurements:
Implement FRET-based biosensors for Rab activation states
Compare GTP/GDP-bound ratios of Rabs in MSRB3 knockdown/overexpression conditions
Assess Rab localization changes as indicators of activation state
Structure-function analysis:
Generate MSRB3 mutants lacking putative GAP domains
Assess the impact of these mutations on both methionine sulfoxide reductase and GAP activities
Determine if the dual functions are structurally segregated
Phenotypic rescue experiments:
Understanding the potential dual functionality requires specialized approaches:
Domain mapping experiments:
Generate deletion constructs targeting specific functional domains
Assess each construct for both reductase and GAP activities
Identify residues critical for each function
Evolutionary analysis:
Compare MSRB3 sequences across species with known MSB3/Gyp3 homologs
Identify conserved motifs potentially involved in GAP activity
Determine when the potential dual functionality emerged evolutionarily
Conditional activation studies:
Investigate whether oxidative stress conditions modulate GAP activity
Determine if methionine oxidation of Rab GTPases affects their interaction with MSRB3
Assess whether MSRB3's reductase activity directly regulates Rab function
Integrated pathway analysis:
Develop models connecting redox regulation with membrane trafficking
Investigate crosstalk between oxidative stress response and endosomal dynamics
Determine physiological conditions where the dual activities would be coordinately regulated
Recent advances in antibody technology can enhance MSRB3 antibody functionality:
Single-domain antibody development:
Generate camelid-derived nanobodies against MSRB3
Exploit their small size for improved tissue penetration in imaging
Utilize for super-resolution microscopy applications
Recombinant antibody fragments:
Develop Fab or scFv fragments for improved penetration
Engineer site-specific conjugation for precise labeling
Create bispecific antibodies targeting MSRB3 and interacting partners
Conformation-specific antibodies:
Generate antibodies recognizing specific MSRB3 states (active/inactive)
Develop tools to distinguish oxidized vs. reduced MSRB3
Integration with microfluidic technologies:
Investigating MSRB3 under oxidative conditions requires specialized approaches:
Oxidative stress induction protocols:
| Oxidative Stress Inducer | Working Concentration | Exposure Time | Primary ROS Generated |
|---|---|---|---|
| Hydrogen peroxide | 100-500 μM | 1-6 hours | H₂O₂, - OH |
| Paraquat | 10-100 μM | 12-24 hours | O₂- − |
| tert-Butyl hydroperoxide | 50-200 μM | 2-8 hours | Lipid peroxides |
| Antimycin A | 1-10 μM | 6-12 hours | Mitochondrial O₂- − |
MSRB3 activity measurements:
Develop assays using specific methionine-R-sulfoxide substrates
Monitor activity changes under various oxidative conditions
Correlate with protein oxidation biomarkers
Redox proteomics approach:
Identify MSRB3 substrates under oxidative challenge
Employ stable isotope labeling to quantify methionine oxidation levels
Compare proteome changes in MSRB3-deficient vs. wild-type cells
Compartment-specific oxidative stress:
Target oxidative stress to specific organelles (mitochondria, ER)
Assess isoform-specific responses (MSRB3A vs. MSRB3B)
Analyze cross-compartmental signaling during oxidative challenge
Combining MSRB3 antibodies with cutting-edge microscopy requires:
Super-resolution microscopy optimization:
Select bright, photostable fluorophores for antibody conjugation
Optimize fixation to preserve nanoscale structures
Consider direct immunofluorescence to minimize spatial displacement
Live-cell imaging strategies:
Develop cell-permeable MSRB3 nanobodies
Utilize split fluorescent protein systems for interaction studies
Implement optogenetic tools to manipulate MSRB3 activity during imaging
Correlative light and electron microscopy (CLEM):
Use MSRB3 antibodies compatible with both immunofluorescence and immunogold labeling
Develop protocols preserving ultrastructure while maintaining antigenicity
Implement metal-tagging technologies for improved correlation
Multiplexed imaging approaches:
Develop cycling immunofluorescence protocols for MSRB3
Integrate with RNA-FISH to correlate protein localization with expression
Implement mass cytometry approaches for high-parameter analysis