MSB3 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to MSRB3 and Its Antibodies

MSRB3 is a zinc-dependent enzyme that reduces methionine sulfoxide back to methionine, mitigating oxidative stress. Antibodies against MSRB3 enable its detection in research models, aiding studies on protein repair mechanisms and disease pathways.

Immunogen and Epitope Details

MSRB3 antibodies are generated using immunogens such as:

  • Peptide sequence: QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC .

  • Recombinant proteins: Fragments spanning amino acids 1–185 or 33–192 of human MSRB3 .

Epitope mapping studies indicate that most antibodies target the N-terminal region (AA 1–185), which is critical for enzymatic activity .

Research Applications

  • Western Blotting (WB): Used to detect MSRB3 in human, mouse, and rat tissues, with validation in cell lysates .

  • Immunofluorescence (IF): Localizes MSRB3 to mitochondria and endoplasmic reticulum in cultured cells .

  • Immunohistochemistry (IHC): Identifies MSRB3 overexpression in cancer tissues, correlating with oxidative stress markers .

Validation and Quality Control

Commercial MSRB3 antibodies undergo rigorous validation:

  • Specificity: Tested against protein arrays of 364 human recombinant proteins to ensure no cross-reactivity .

  • Reproducibility: Verified in IHC using tissue microarrays of 44 normal and 20 cancerous human tissues .

  • Functional assays: Antibodies like ABIN7264063 show >90% purity via SDS-PAGE .

Research Findings

  • Cancer: Elevated MSRB3 levels are linked to chemotherapy resistance in multiple myeloma, with antibodies used to quantify expression in clinical samples .

  • Neurology: MSRB3 knockdown models (using siRNA) exhibit increased neuronal apoptosis, validated via antibody-based assays .

Limitations and Considerations

  • Species cross-reactivity: Most antibodies are validated for humans and mice, with limited data on other species .

  • Post-translational modifications: Current antibodies target unmodified MSRB3; phosphorylation or ubiquitination sites may require custom reagents .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
MSB3 antibody; GYP3 antibody; YNL293W antibody; N0470 antibody; GTPase-activating protein GYP3 antibody; Multicopy suppressor of bud emergence 3 antibody; Protein MSB3 antibody
Target Names
MSB3
Uniprot No.

Target Background

Function
MSB3 antibody regulates exocytosis by functioning as a GTPase-activating protein (GAP) for SEC4. It specifically stimulates the GTPase activity of YPT6. Additionally, MSB3 is required for efficient polarization of actin patches.
Gene References Into Functions
  1. BLOC-1 serves as both a Vps21 effector and an adapter for its GAP Msb3. PMID: 23547030
  2. Msb3 exhibits the capacity to act on multiple substrates in vivo, at both ends of a trafficking pathway. PMID: 22593206
  3. Research suggests a potential role for Msb3p in calcineurin-mediated signaling. PMID: 20872164
Database Links

KEGG: sce:YNL293W

STRING: 4932.YNL293W

Subcellular Location
Cytoplasm. Bud. Bud neck. Note=Localizes to the presumptive bud site, the bud tip and the mother-bud neck.

Q&A

What is MSRB3 and why is it relevant to biological research?

MSRB3 (Methionine Sulfoxide Reductase B3) is an enzyme that catalyzes the reduction of methionine-R-sulfoxide to methionine, playing a crucial role in protein repair mechanisms and cellular protection against oxidative stress. In yeast, the homolog Msb3 functions as a GTPase-activating protein (GAP) for Rab GTPases such as Vps21, influencing membrane trafficking and cellular polarity . Research on MSRB3 contributes to our understanding of cellular redox homeostasis, protein quality control, and membrane trafficking pathways, making it relevant across multiple fields including neuroscience, aging research, and cell biology.

What types of MSRB3 antibodies are currently available for research?

Current research-grade MSRB3 antibodies include both polyclonal and monoclonal variants with different specificities and applications. Polyclonal antibodies targeting amino acids 1-185 or 33-192 of the MSRB3 protein are commonly available from rabbit hosts . Monoclonal antibodies, including specific clones like 2A2 and 6F9, offer more targeted recognition . These antibodies vary in their reactivity profiles (human, mouse, rat) and are optimized for different applications including Western Blotting (WB), ELISA, Immunohistochemistry (IHC), and Immunofluorescence (IF) .

How should I select the appropriate MSRB3 antibody for my specific research application?

Selection should be based on a systematic evaluation of several parameters:

  • Target species compatibility: Confirm reactivity with your experimental model (human, mouse, rat)

  • Application requirements: Choose antibodies validated for your specific technique (WB, ELISA, IHC, IF)

  • Epitope recognition: Consider whether you need antibodies targeting specific regions (e.g., AA 1-185 vs. AA 33-192)

  • Clonality considerations:

    • Polyclonal antibodies offer broader epitope recognition but potentially higher background

    • Monoclonal antibodies provide consistent specificity with potentially narrower recognition range

  • Conjugation needs: Determine whether unconjugated or conjugated antibodies are required based on detection systems

What are the optimal conditions for using MSRB3 antibodies in Western Blotting?

For Western Blotting applications with MSRB3 antibodies, the following protocol optimizations are recommended:

  • Sample preparation:

    • Use RIPA or NP-40 based lysis buffers with protease inhibitors

    • Include reducing agents (DTT/β-mercaptoethanol) in sample buffer

  • Dilution ranges:

    • For polyclonal MSRB3 antibodies: 1:1000-1:5000 dilution in 5% BSA or milk in TBST

    • For monoclonal variants: Follow manufacturer's recommendations, typically 1:1000

  • Blocking conditions:

    • 5% non-fat dry milk or BSA in TBST for 1 hour at room temperature

    • For phospho-specific detection, BSA is preferred over milk

  • Incubation parameters:

    • Primary antibody: Overnight at 4°C with gentle agitation

    • Secondary antibody: 1 hour at room temperature

  • Expected molecular weight: Confirm band detection at approximately 21 kDa (MSRB3 isoform A) or 18 kDa (MSRB3 isoform B)

How can I optimize MSRB3 antibody use for immunohistochemistry applications?

Effective IHC protocols for MSRB3 detection require:

  • Tissue preparation:

    • Formalin-fixed paraffin-embedded (FFPE) sections: 5 μm thickness

    • Fresh frozen sections: 8-10 μm thickness

  • Antigen retrieval:

    • Heat-mediated: Citrate buffer (pH 6.0) for 20 minutes

    • For challenging tissues: Try EDTA buffer (pH 9.0)

  • Antibody dilution:

    • Starting range: 1:20-1:200 as recommended

    • Optimal dilution determination through titration experiments

  • Signal enhancement strategies:

    • Consider biotin-streptavidin amplification systems

    • Tyramide signal amplification for low-abundance targets

  • Controls:

    • Positive control: Tissues with known MSRB3 expression

    • Negative control: Isotype control or pre-immune serum

    • Absorption control: Primary antibody pre-incubated with immunizing peptide

What are the recommended protocols for validating newly purchased MSRB3 antibodies?

A comprehensive validation approach should include:

  • Western blot analysis:

    • Test against recombinant MSRB3 protein as positive control

    • Compare expression in multiple cell lines with known MSRB3 expression levels

    • Include MSRB3 knockout/knockdown samples as negative controls

  • Cross-reactivity assessment:

    • Test against closely related family members (MSRB1, MSRB2)

    • Evaluate across multiple species if working with diverse models

  • Application-specific validation:

    • For WB: Optimize sample preparation, blocking conditions, antibody dilutions

    • For IHC/IF: Compare staining patterns with published data

    • For ELISA: Generate standard curves with recombinant protein

  • Epitope verification:

    • Perform peptide competition assays using the immunizing peptide

    • For antibodies targeting AA 1-185 or AA 33-192 regions, verify specificity to these domains

How can I distinguish between MSRB3 isoforms using currently available antibodies?

MSRB3 exists in multiple isoforms, requiring careful consideration for isoform-specific detection:

  • Isoform characteristics:

    • MSRB3A: Contains mitochondrial targeting sequence

    • MSRB3B: Contains endoplasmic reticulum targeting sequence

  • Antibody selection strategy:

    • For isoform-specific detection: Choose antibodies targeting unique N-terminal regions

    • For pan-MSRB3 detection: Select antibodies against common C-terminal regions

  • Experimental verification methods:

    • Western blot analysis with recombinant isoform standards

    • Subcellular fractionation combined with immunoblotting

    • Immunofluorescence co-localization with organelle markers

  • Data interpretation:

    • MSRB3A appears at approximately 21 kDa

    • MSRB3B appears at approximately 18 kDa

    • Consider potential post-translational modifications affecting mobility

What approaches can resolve inconsistent results when detecting MSRB3 in different cell types?

When facing variable MSRB3 detection across cell types:

  • Expression level variations:

    • Quantify baseline MSRB3 expression through qRT-PCR

    • Consider cell-type specific regulation affecting protein abundance

  • Protein extraction optimization:

    • For membrane-associated MSRB3: Use detergent solubilization (Triton X-100, NP-40)

    • For cytosolic fractions: Use gentler lysis buffers

    • Include phosphatase inhibitors to preserve post-translational modifications

  • Antibody compatibility assessment:

    • Test multiple antibodies targeting different epitopes

    • Evaluate whether specific cell types might express variant forms

  • Signal enhancement strategies:

    • For low-abundance detection: Consider enrichment through immunoprecipitation

    • Implement signal amplification systems for IHC/IF applications

  • Cross-validation approach:

    • Combine protein detection with mRNA analysis

    • Utilize overexpression and knockdown controls in challenging cell types

How can MSRB3 antibodies be employed to study its role in membrane trafficking pathways?

Based on the homology to yeast Msb3, which functions as a GAP for Rab GTPases , researchers can investigate MSRB3's role in membrane trafficking through:

  • Co-immunoprecipitation studies:

    • Utilize MSRB3 antibodies to pull down protein complexes

    • Analyze interactions with suspected Rab GTPases and effector proteins

    • Quantify interactions under different cellular conditions

  • Subcellular localization mapping:

    • Employ cell fractionation followed by Western blotting

    • Perform immunofluorescence co-localization with endosomal markers

    • Consider super-resolution microscopy for detailed localization analysis

  • Functional assays:

    • Analyze endocytic trafficking rates in MSRB3 knockdown/knockout cells

    • Assess vacuole/endosome morphology changes similar to those observed in yeast Msb3 studies

    • Investigate potential GAP activity toward mammalian Rab GTPases

  • Dynamic interaction studies:

    • Implement proximity ligation assays to detect transient interactions

    • Perform FRET/BRET analysis with tagged MSRB3 and suspected partners

How does MSRB3 function differ from other methionine sulfoxide reductase family members?

MSRB3 exhibits distinct characteristics compared to other MSR family members:

  • Substrate specificity:

    • MSRB3 specifically reduces methionine-R-sulfoxides

    • MSRA reduces methionine-S-sulfoxides

    • This stereospecificity is critical for comprehensive protein repair

  • Subcellular localization:

    • MSRB3A: Primarily mitochondrial

    • MSRB3B: Endoplasmic reticulum

    • MSRB1: Cytosolic and nuclear

    • MSRB2: Mitochondrial

  • Catalytic mechanism:

    • MSRB3 utilizes specific active site residues for catalysis

    • Different cofactor requirements compared to other family members

  • Physiological roles:

    • MSRB3 may have specialized functions in specific tissues

    • Evidence suggests roles in hearing development and cardiac function

What experimental approaches can reveal the GAP activity of MSRB3 toward Rab GTPases?

Based on the yeast Msb3 studies , researchers can investigate potential GAP activity through:

  • In vitro GAP assays:

    • Purify recombinant MSRB3 and candidate Rab GTPases

    • Measure GTP hydrolysis rates in the presence/absence of MSRB3

    • Analyze the impact of mutations in the catalytic arginine residue (equivalent to R282 in yeast Msb3)

  • Cellular GTPase activity measurements:

    • Implement FRET-based biosensors for Rab activation states

    • Compare GTP/GDP-bound ratios of Rabs in MSRB3 knockdown/overexpression conditions

    • Assess Rab localization changes as indicators of activation state

  • Structure-function analysis:

    • Generate MSRB3 mutants lacking putative GAP domains

    • Assess the impact of these mutations on both methionine sulfoxide reductase and GAP activities

    • Determine if the dual functions are structurally segregated

  • Phenotypic rescue experiments:

    • Express MSRB3 in yeast msb3Δ cells to assess functional conservation

    • Test whether human MSRB3 can rescue the vacuole morphology defects seen in msb3Δ yeast

What is the relationship between MSRB3's methionine sulfoxide reductase activity and its potential GAP function?

Understanding the potential dual functionality requires specialized approaches:

  • Domain mapping experiments:

    • Generate deletion constructs targeting specific functional domains

    • Assess each construct for both reductase and GAP activities

    • Identify residues critical for each function

  • Evolutionary analysis:

    • Compare MSRB3 sequences across species with known MSB3/Gyp3 homologs

    • Identify conserved motifs potentially involved in GAP activity

    • Determine when the potential dual functionality emerged evolutionarily

  • Conditional activation studies:

    • Investigate whether oxidative stress conditions modulate GAP activity

    • Determine if methionine oxidation of Rab GTPases affects their interaction with MSRB3

    • Assess whether MSRB3's reductase activity directly regulates Rab function

  • Integrated pathway analysis:

    • Develop models connecting redox regulation with membrane trafficking

    • Investigate crosstalk between oxidative stress response and endosomal dynamics

    • Determine physiological conditions where the dual activities would be coordinately regulated

How can advanced antibody engineering improve MSRB3 antibody performance in research applications?

Recent advances in antibody technology can enhance MSRB3 antibody functionality:

  • Single-domain antibody development:

    • Generate camelid-derived nanobodies against MSRB3

    • Exploit their small size for improved tissue penetration in imaging

    • Utilize for super-resolution microscopy applications

  • Recombinant antibody fragments:

    • Develop Fab or scFv fragments for improved penetration

    • Engineer site-specific conjugation for precise labeling

    • Create bispecific antibodies targeting MSRB3 and interacting partners

  • Conformation-specific antibodies:

    • Generate antibodies recognizing specific MSRB3 states (active/inactive)

    • Develop tools to distinguish oxidized vs. reduced MSRB3

  • Integration with microfluidic technologies:

    • Utilize rapid antibody discovery platforms similar to those described for SARS-CoV-2 antibodies

    • Screen antibody-secreting cells for high-affinity MSRB3 binders

    • Apply single-cell sequencing for deeper repertoire analysis

What methodological considerations are important when studying MSRB3 in the context of oxidative stress?

Investigating MSRB3 under oxidative conditions requires specialized approaches:

  • Oxidative stress induction protocols:

    Oxidative Stress InducerWorking ConcentrationExposure TimePrimary ROS Generated
    Hydrogen peroxide100-500 μM1-6 hoursH₂O₂, - OH
    Paraquat10-100 μM12-24 hoursO₂- −
    tert-Butyl hydroperoxide50-200 μM2-8 hoursLipid peroxides
    Antimycin A1-10 μM6-12 hoursMitochondrial O₂- −
  • MSRB3 activity measurements:

    • Develop assays using specific methionine-R-sulfoxide substrates

    • Monitor activity changes under various oxidative conditions

    • Correlate with protein oxidation biomarkers

  • Redox proteomics approach:

    • Identify MSRB3 substrates under oxidative challenge

    • Employ stable isotope labeling to quantify methionine oxidation levels

    • Compare proteome changes in MSRB3-deficient vs. wild-type cells

  • Compartment-specific oxidative stress:

    • Target oxidative stress to specific organelles (mitochondria, ER)

    • Assess isoform-specific responses (MSRB3A vs. MSRB3B)

    • Analyze cross-compartmental signaling during oxidative challenge

How can researchers effectively integrate MSRB3 antibodies with advanced imaging techniques?

Combining MSRB3 antibodies with cutting-edge microscopy requires:

  • Super-resolution microscopy optimization:

    • Select bright, photostable fluorophores for antibody conjugation

    • Optimize fixation to preserve nanoscale structures

    • Consider direct immunofluorescence to minimize spatial displacement

  • Live-cell imaging strategies:

    • Develop cell-permeable MSRB3 nanobodies

    • Utilize split fluorescent protein systems for interaction studies

    • Implement optogenetic tools to manipulate MSRB3 activity during imaging

  • Correlative light and electron microscopy (CLEM):

    • Use MSRB3 antibodies compatible with both immunofluorescence and immunogold labeling

    • Develop protocols preserving ultrastructure while maintaining antigenicity

    • Implement metal-tagging technologies for improved correlation

  • Multiplexed imaging approaches:

    • Develop cycling immunofluorescence protocols for MSRB3

    • Integrate with RNA-FISH to correlate protein localization with expression

    • Implement mass cytometry approaches for high-parameter analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.