hs6st3b Antibody

What is HS6ST3 and why is it important in biological research?

HS6ST3 (Heparan Sulfate 6-O-Sulfotransferase 3) is a member of the sulfotransferase 6 family of enzymes that plays a crucial role in modifying heparan sulfate (HS) to generate structures required for interactions between HS and various proteins. These interactions are implicated in numerous biological processes including cell proliferation, differentiation, adhesion, migration, inflammation, and blood coagulation . HS6ST3 specifically sulfates the #6 position of glucosamine sulfate linked to 2-O-sulfated iduronic acid in heparan sulfate, contributing to the fine-tuning of HS structures that mediate specific protein interactions . The temporal expression pattern of HS6ST3 in postnatal cerebellar Purkinje cells and cerebral cortical pyramidal cells suggests its importance in neuronal development and function .

What are the structural and biochemical properties of HS6ST3 protein?

Mouse HS6ST3 is a 470 amino acid (aa) type II transmembrane glycoprotein with a molecular weight of approximately 55-60 kDa . The protein structure includes:

• A short four amino acid cytoplasmic N-terminus

• An extended 443 amino acid lumenal domain (aa 28-470)

• A stem region (aa 28-83) that mediates oligomerization and Golgi localization

• A sulfotransferase enzyme domain (aa 142-409)

Importantly, cleavage within the stem region by beta-secretase can generate a soluble form of HS6ST3 . The high degree of conservation across species (mouse HS6ST3 shares 99% amino acid identity with rat and 95% with human HS6ST3) suggests evolutionary importance of this enzyme .

What are the common applications for HS6ST3 antibodies in research?

HS6ST3 antibodies are valuable tools for multiple research applications:

• Western blotting for protein expression analysis and quantification

• Immunohistochemistry (IHC) for localization studies in tissues

• Detection of HS6ST3 in neuronal cell bodies, particularly in the trigeminal ganglion

• Investigation of HS6ST3's role in development, disease progression, and cellular signaling pathways

How should researchers optimize immunohistochemical detection of HS6ST3 in neural tissues?

For optimal immunohistochemical detection of HS6ST3 in neural tissues, researchers should consider the following protocol based on published methodologies:

• Use perfusion-fixed frozen sections (particularly effective for brain tissue analysis)

• Apply HS6ST3 antibody at a concentration of 5 μg/mL

• Incubate overnight at 4°C to ensure adequate penetration and binding

• Visualize using appropriate detection systems such as HRP-DAB (Anti-Sheep HRP-DAB Cell & Tissue Staining Kit has been successfully used)

• Counterstain with hematoxylin to provide cellular context

• Pay particular attention to neuronal cell bodies, where specific staining is typically localized

This approach has successfully demonstrated HS6ST3 localization in mouse trigeminal ganglion, suggesting its utility for other neural tissue analyses.

What considerations are important when selecting an HS6ST3 antibody for Western blotting applications?

When selecting an HS6ST3 antibody for Western blotting, researchers should consider:

• Target epitope: Different antibodies target different regions of HS6ST3 (C-terminal, N-terminal, etc.). Choose based on your research question - for instance, C-terminal antibodies can detect both full-length and cleaved forms .

• Species reactivity: Verify cross-reactivity with your species of interest. Available antibodies show reactivity to various species including mouse, human, rat, guinea pig, rabbit, cow, dog, horse, and zebrafish with varying degrees of predicted sequence homology .

• Validation status: Select antibodies validated specifically for Western blotting using appropriate positive controls (cell lysates) .

• Working concentration: Titrate to determine optimal concentration, with 1 μg/mL being a recommended starting point .

• Storage and handling: Follow manufacturer recommendations for reconstitution, storage temperature (-20°C to -70°C), and avoidance of freeze-thaw cycles to maintain antibody efficacy .

What are common challenges in HS6ST3 antibody-based experiments and how can they be addressed?

Researchers commonly encounter several challenges when working with HS6ST3 antibodies:

How can researchers validate the specificity of HS6ST3 antibody staining in experimental systems?

Validating HS6ST3 antibody specificity requires multiple complementary approaches:

• Blocking peptide controls: Use synthetic peptides corresponding to the immunogen sequence (e.g., "TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW" for C-terminal antibodies) to compete with and block specific binding .

• Positive tissue controls: Include tissues with known HS6ST3 expression (e.g., mouse trigeminal ganglion) to verify staining patterns .

• Multiple antibody validation: Compare staining patterns using antibodies targeting different epitopes of HS6ST3 (N-terminal vs. C-terminal) .

• Correlation with mRNA expression: Combine antibody detection with RT-PCR or in situ hybridization to confirm expression patterns.

• Genetic models: When available, use tissues from HS6ST3 knockout or knockdown models as negative controls.

How can researchers investigate the relationship between HS6ST3 expression and neuronal development or pathology?

To investigate HS6ST3's role in neuronal contexts, researchers should consider this multi-faceted approach:

• Temporal expression analysis: Track HS6ST3 expression across developmental stages using validated antibodies in Western blot and IHC applications. Focus on cerebellar Purkinje cells and cerebral cortical pyramidal cells in layers II/III and V, where temporal expression patterns have been observed .

• Co-localization studies: Combine HS6ST3 antibody staining with markers for specific neuronal subtypes, developmental stages, or pathological conditions using dual immunofluorescence.

• Functional perturbation: Employ genetic approaches (CRISPR/Cas9, shRNA) to modify HS6ST3 expression, followed by phenotypic and molecular analyses using validated antibodies.

• Sulfation pattern analysis: Combine HS6ST3 antibody detection with analytical methods to correlate enzyme expression with changes in heparan sulfate structural modifications.

• Protein interaction studies: Use co-immunoprecipitation with HS6ST3 antibodies to identify protein binding partners in neuronal contexts, providing insight into regulatory networks.

What approaches can be used to study the role of post-translational modifications and processing of HS6ST3?

Investigating post-translational modifications and processing of HS6ST3 requires sophisticated methodological approaches:

• Beta-secretase cleavage analysis: Since HS6ST3 can be cleaved by beta-secretase within its stem region to generate a soluble form , researchers can use antibodies targeting different domains to differentiate between membrane-bound and soluble forms in Western blotting.

• Subcellular fractionation: Combine with domain-specific antibodies to track the localization of various HS6ST3 forms in cellular compartments, particularly focusing on Golgi localization mediated by the stem region (aa 28-83) .

• Glycosylation analysis: As HS6ST3 is a glycoprotein, treatment with glycosidases followed by Western blotting can reveal glycosylation patterns and their functional significance.

• Oligomerization studies: Use non-denaturing gel electrophoresis combined with HS6ST3 antibody detection to study the oligomerization mediated by the stem region .

• Site-directed mutagenesis: Create mutations at potential post-translational modification sites, followed by antibody-based detection to determine functional consequences.

How should researchers interpret differences in HS6ST3 expression patterns across different tissues and developmental stages?

When analyzing HS6ST3 expression patterns:

• Consider isoform specificity: HS6ST3 is one of three 6-O sulfotransferase isoforms that perform similar functions but are encoded by distinct genes . Validate antibody specificity to ensure you're detecting the intended isoform.

• Evaluate cellular context: HS6ST3 shows specific localization to neuronal cell bodies in certain brain regions . Differences in expression may reflect tissue-specific functions rather than experimental artifacts.

• Assess temporal patterns: HS6ST3 exhibits temporal expression in postnatal cerebellar Purkinje cells and cerebral cortical pyramidal cells . Developmental timing may be crucial for interpreting results.

• Quantify expression levels: Use densitometry for Western blots or quantitative image analysis for IHC to objectively compare expression across samples.

• Correlate with functional outcomes: Connect expression patterns with biological phenotypes or molecular changes to establish functional relevance.

What considerations are important when comparing results from different HS6ST3 antibodies in the same experimental system?

When comparing results from different HS6ST3 antibodies:

• Epitope differences: Antibodies targeting different regions (N-terminal, C-terminal, internal domains) may yield varying results depending on protein conformation, processing, or interactions .

• Antibody format and host species: Compare only results obtained with similar antibody formats (e.g., polyclonal vs. monoclonal) and consider potential differences in sensitivity and specificity .

• Detection method consistency: Ensure consistent secondary antibody systems and detection methods when comparing results from primary antibodies raised in different host species .

• Validation controls: Include appropriate positive and negative controls for each antibody to establish the valid detection range .

• Cross-reactivity profiles: Consider the predicted reactivity profiles for different species (e.g., Cow: 93%, Dog: 100%, Guinea Pig: 100%, Horse: 93%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 91%) when comparing results across species.