hsh2d Antibody

What is HSH2D and what is its primary function in cellular signaling?

HSH2D functions as an adapter protein involved in tyrosine kinase and CD28 signaling pathways. It modulates the apoptotic response through its ability to affect mitochondrial stability and impacts CD28-mediated activation of the RE/AP element of the interleukin-2 promoter . HSH2D is an important signaling molecule that affects T-cell activation, specifically by inhibiting the transcriptional activation of the IL-2 promoter, especially at the RE/AP element mediated by CD28 .

What is the tissue expression profile of HSH2D?

HSH2D is predominantly expressed in spleen and hematopoietic cells such as peripheral blood leukocytes. It is weakly expressed in prostate, thymus, heart, small intestine, and placenta . Expression analysis from the Haferlach leukemia data set (Oncomine database) indicates that HSH2D expression is downregulated in T-ALL compared to B-ALL, with pro-B ALL showing the highest expression levels .

What techniques are recommended for detecting HSH2D expression?

Several complementary techniques have proven effective for HSH2D detection:

How should HSH2D antibodies be validated for research applications?

Validating HSH2D antibodies requires multiple approaches to ensure specificity and reproducibility. Begin with a blocking peptide assay by mixing equal volumes of peptide and antibody at the required dilution and incubating at ambient temperature for 20 minutes. Then develop in parallel two blots: one with the antibody alone and another with the pre-absorbed antibody-peptide mixture . Additionally, validation should include positive controls such as COLO205 cell lysate, which has been demonstrated to express HSH2D . Western blot analysis should confirm detection at the predicted molecular weight of 39 kDa to verify specificity .

How does HSH2D contribute to methotrexate resistance in T-cell acute lymphoblastic leukemia?

HSH2D plays a critical role in methotrexate (MTX) resistance in T-ALL. Comparative analysis of MTX-resistant and MTX-sensitive cell lines revealed significantly higher HSH2D expression in resistant cells, both at protein and mRNA levels . The IC50 value of resistant cell lines (1.773×10^-8-3.367×10^-8 M) was substantially higher than sensitive strains (3.847×10^-9-4.802×10^-9 M), indicating that HSH2D expression correlates with reduced MTX cytotoxicity . This suggests that HSH2D may be a potential therapeutic target for overcoming drug resistance in T-ALL treatment protocols.

What methodologies are effective for manipulating HSH2D expression in experimental models?

Two primary approaches have been validated for HSH2D manipulation:

• siRNA-mediated knockdown: Effective siRNA sequences targeting HSH2D include:

  • siHSH2D: 5′-UGGUUAUUCUGUUCAUCUCUGTT-3′ and 5′-CAGAGAUGAACAGAAUAACCATT-3′

  • siHSH2D-2: 5′-AGCTGGAGTGGAATGGCACAGTCTATT-3′ and 5′-TAGACTGTGCCATTCCACTCCAGCTTT-3′

• Plasmid-based overexpression: Using pcDNA3.1-HSH2D expression vectors transfected with Lipofectamine® 2000

Both approaches should be validated through western blotting and RT-qPCR at 48 hours post-transfection before proceeding with functional analyses. Cell harvest after this timepoint is appropriate for cell cycle analysis, EdU assay, and additional downstream applications .

What is the relationship between HSH2D and IL-2 signaling in T-cells?

HSH2D functions as a negative regulator of IL-2 production in T-cells. Experimental evidence demonstrates that overexpression of HSH2D inhibits IL-2 transcription, while HSH2D knockdown promotes exocrine IL-2 secretion . This regulatory pathway operates through CD28, which plays a key role in IL-2 transcriptional expression. When exogenous IL-2 (50 ng/ml or 100 U) is added to HUT-78 cells transfected with HSH2D expression vectors, HSH2D expression can be restored . Western blotting and RT-qPCR analyses confirm that HSH2D overexpression inhibits both CD28 and IL-2 protein expression, establishing a clear inhibitory relationship .

How can researchers differentiate between HSH2D expression patterns in different leukemia subtypes?

Differential expression analysis requires integrating multiple databases and experimental approaches:

• Oncomine database analysis: The Haferlach leukemia dataset reveals that pro-B ALL has the highest HSH2D expression, while T-ALL shows lower expression compared to peripheral blood mononuclear cells .

• Gene Expression Omnibus (GEO) data: Analysis of NCBI GEO database (dataset record GDS4299) demonstrates that HSH2D expression is markedly higher in early T-cell precursor ALL (ETP-ALL) compared to classical T-ALL, providing potential diagnostic markers .

• Western blot verification: Protein expression analysis should be performed with carefully selected controls to confirm transcriptional findings. The 39 kDa band corresponding to HSH2D should be quantified using Gel-Pro-Analyzer Plus 4.0 or similar densitometry software .

What experimental controls are essential when studying HSH2D protein interactions?

When investigating HSH2D protein interactions and signaling pathways, the following controls are essential:

• Negative control for siRNA experiments: Use of non-targeting sequence (e.g., 5′-UUCUCCGAACGUGUCACGUTT-3′ and 5′-ACGUGACACGUUCGGAGAATT-3′) at appropriate concentration (50 nM) .

• Empty vector control: For overexpression studies, include the empty pcDNA3.1 vector to control for transfection effects.

• Loading controls: For western blotting, β-actin (ab8226; 1:5,000) or GAPDH (ab8245, 1:2,000) antibodies have been validated for normalization .

• Recombinant protein controls: When studying IL-2 signaling, include recombinant human IL-2 (50 ng/ml) treatment conditions to establish pathway responsiveness .

What are common challenges in HSH2D antibody applications and how can they be addressed?

When working with HSH2D antibodies, researchers frequently encounter several technical challenges:

• Non-specific binding: Pre-absorb the antibody with the immunizing peptide to confirm specificity. The HSH2D peptide corresponds to the C-terminal region (amino acids 295-344: RSVSCIEVTPGDRSWHQMVVRALSSQESKPEHQGLAEPENQDLPEEYQQP) .

• Inconsistent detection: Store antibodies at -20°C and reconstitute peptides to 0.5 mg/mL concentration. Minimize freeze-thaw cycles to maintain antibody integrity .

• Background issues in Western blots: Optimal blocking with 5% non-fat dry milk in 0.05% PBS-T has been demonstrated to produce clear results with HSH2D antibodies .

How should researchers interpret conflicting HSH2D expression data across different experimental platforms?

When facing contradictory results across different detection methods:

What are the optimal protein extraction methods for HSH2D detection in different cell types?

Protein extraction for HSH2D analysis should be tailored to cellular localization. Since HSH2D is present in both cytoplasm and nucleus , a comprehensive extraction protocol is recommended:

• Cells should be lysed in RIPA buffer supplemented with protease inhibitors.

• Protein concentration determination using BCA protein concentration assay is appropriate for HSH2D detection .

• For Western blotting, 20 μg of total protein subjected to 10% SDS-PAGE provides optimal results .

• Transfer to PVDF membranes followed by 5% skim milk blocking at room temperature for 1 hour ensures low background .

How might HSH2D antibodies contribute to developing targeted therapies for drug-resistant leukemias?

Given HSH2D's role in methotrexate resistance in T-ALL, antibody-based approaches could be developed to target HSH2D-mediated pathways. Potential strategies include:

• Developing antibody-drug conjugates targeting cells with high HSH2D expression.

• Using HSH2D antibodies to screen for compounds that modulate its expression or activity.

• Combining HSH2D targeting with conventional chemotherapy to overcome resistance mechanisms.

• Exploiting the differential expression of HSH2D between T-ALL and B-ALL for selective targeting strategies.

What experimental approaches could better elucidate the relationship between HSH2D and other signaling molecules in the CD28 pathway?

To further understand HSH2D's role in T-cell signaling networks:

• Conduct co-immunoprecipitation experiments using HSH2D antibodies to identify novel interaction partners.

• Employ proximity ligation assays to visualize HSH2D-CD28 interactions in situ.

• Utilize CRISPR-Cas9 genome editing to create HSH2D knockout models for pathway analysis.

• Perform phosphoproteomics to identify HSH2D-dependent signaling events following CD28 activation.

• Investigate the impact of HSH2D mutations on IL-2 promoter activity using reporter gene assays.