IGFL1 Antibody

What is IGFL1 and what makes it a significant research target?

IGFL1 is a secreted protein belonging to the insulin-like growth factor-like (IGFL) family. It contains approximately 100 amino acids with 11 conserved cysteine residues at fixed positions, including two characteristic CC motifs. In humans, the IGFL family comprises four genes (IGFL1, IGFL2, IGFL3, and IGFL4) and two pseudogenes (IGFL1P1 and IGFL1P2), clustered on chromosome 19 within a 35-kb interval .

IGFL1 has emerged as a significant research target due to:

• Its potential role as an oncogene in certain cancer types, particularly basal-like breast cancer

• Its upregulation in inflammatory skin conditions like psoriasis

• Its interaction with the IGFLR1 receptor, which bears structural similarity to tumor necrosis factor receptors

• Its restricted tissue expression pattern, suggesting specialized biological functions

What are the key considerations when selecting an IGFL1 antibody for research?

When selecting an IGFL1 antibody for research applications, consider:

• Specificity validation: Verify the antibody has been tested on tissues known to express IGFL1 positively and negatively

• Application suitability: Confirm validation for your specific application (WB, IHC, IF/ICC, ELISA)

• Epitope information: Check the immunogen sequence to ensure it targets your region of interest; many IGFL1 antibodies are raised against the sequence "TPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSD"

• Species reactivity: Most commercial antibodies target human IGFL1 with limited cross-reactivity to mouse and rat (typically 30-33% sequence identity)

• Validation data: Review available characterization data, such as those provided through resources like the Human Protein Atlas for Prestige Antibodies

What are the optimal methods for detecting IGFL1 expression in tissue samples?

For detecting IGFL1 expression in tissue samples, multiple complementary approaches should be considered:

Transcriptional analysis:

• RT-PCR using validated primer/probe sets for IGFL1

• RNA microarray analysis normalized to housekeeping genes like RPL19

• In situ hybridization with radioactive probes to localize IGFL1 mRNA in tissue sections

Protein detection:

• Immunohistochemistry (IHC) with validated anti-IGFL1 antibodies at dilutions of 1:50-1:200

• Western blot analysis using cell lysates with known IGFL1 expression as positive controls

• Flow cytometry for detection in cell populations (though less commonly used for IGFL1)

A multifaceted approach combining both mRNA and protein detection methods provides the most reliable assessment of IGFL1 expression, as protein expression does not always correlate with mRNA levels.

How can researchers effectively measure IGFL1-IGFLR1 interactions in experimental settings?

Measuring IGFL1-IGFLR1 interactions requires specialized techniques:

• Binding assays:

  • Functional ELISA where immobilized IGFLR1 (approximately 2 μg/ml) can bind human IGFL1 with EC50 values of 32.33-47.52 ng/mL

  • Flow cytometry-based binding assays using FLAG-tagged IGFL1 and cells expressing IGFLR1

• Co-immunoprecipitation:

  • Use anti-IGFLR1 antibodies to capture IGFLR1 complexes, followed by detection of bound IGFL1

  • The reverse approach can also be used with anti-IGFL1 antibodies

• Sandwich ELISA detection:

  • Plates coated with IGFLR1-Fc to capture IGFL1, then detected with HRP-conjugated anti-FLAG antibodies (if using FLAG-tagged IGFL1)

• Fluorescence-based approaches:

  • Use GFP-tagged IGFLR1 in HEK293T cells incubated with FLAG-tagged IGFL1, detected with Alexa Fluor-647-labeled anti-FLAG antibodies

What is the evidence for IGFL1's role in inflammatory skin diseases, particularly psoriasis?

The involvement of IGFL1 in inflammatory skin conditions, particularly psoriasis, is supported by several lines of evidence:

• Differential expression: IGFL1 transcripts are uniquely and significantly induced in psoriatic skin samples compared to normal skin

• Regulation by inflammatory mediators: IGFL1 expression is upregulated in cultured primary keratinocytes stimulated with tumor necrosis factor α (TNFα), but not by other psoriasis-associated cytokines

• Receptor expression pattern: The receptor for IGFL1, known as IGFLR1, is expressed primarily on T cells, which are key mediators of inflammatory responses in psoriasis

• Enhanced expression in models of inflammation: The mouse ortholog of IGFL1 (mIGFL) shows enhanced expression in models of skin wounding and psoriatic-like inflammation

• Mechanistic connection: The interaction between IGFL1 and IGFLR1 may influence T cell biology within inflammatory skin conditions, potentially contributing to disease pathogenesis

This evidence suggests that the IGFL1-IGFLR1 axis may represent a novel pathway in inflammatory skin conditions and could potentially serve as a therapeutic target.

How is IGFL1 implicated in cancer progression, and which cancer types show the most significant associations?

IGFL1 has been implicated in cancer progression with varying degrees of evidence across different cancer types:

Basal-like breast cancer:

• Studies have identified IGFL1 as an oncogene that contributes to proliferation and growth of basal-like breast cancer cells

• The KLF5-induced lncRNA IGFL2-AS1 promotes basal-like breast cancer cell growth and survival by upregulating IGFL1 expression

Clear cell renal cell carcinoma (ccRCC):

• IGFLR1 (the receptor for IGFL1) has been investigated as a prognostic biomarker in ccRCC

• Analysis of TCGA data revealed differences in IGFLR1 expression between cancer and para-cancer tissues, with potential implications for IGFL1 signaling

Other cancer types:

• Database analyses have shown IGFL1 expression in squamous cell carcinoma, uterine tumors, and head and neck tumors

• The specific mechanisms by which IGFL1 may contribute to these cancer types remain under investigation

The involvement of IGFL1 in cancer may be related to its ability to promote cell proliferation and survival through various signaling pathways, potentially including β-arrestin-biased signaling as observed with related receptors in the IGF family .

How does IGFL1 signaling differ from canonical IGF1R signaling, and what are the implications for experimental design?

IGFL1 signaling through IGFLR1 differs substantially from canonical IGF1R signaling, with important implications for experimental design:

Key differences:

• Receptor structure and family:

  • IGFLR1 bears structural similarity to tumor necrosis factor receptor (TNFR) family members, not the receptor tyrosine kinase family to which IGF1R belongs

  • This suggests fundamentally different signaling mechanisms

• Downstream signaling pathways:

  • While IGF1R primarily signals through kinase-dependent pathways (PI3K/AKT, MAPK/ERK)

  • IGFLR1 may signal through mechanisms more similar to TNFR family members

  • Studies of related receptors suggest potential involvement of β-arrestin-mediated signaling

• Expression patterns:

  • IGFLR1 is predominantly expressed on T cells (in mice)

  • IGF1R is broadly expressed across many tissue types

Experimental design implications:

• Assay selection: Traditional IGF1R activation assays focusing on kinase phosphorylation may not capture IGFL1-IGFLR1 signaling; researchers should consider alternative readouts

• Cell type considerations: Given the T cell-specific expression of IGFLR1, experiments should utilize appropriate T cell models rather than the epithelial or fibroblast models often used for IGF1R research

• Interaction with inflammatory pathways: Experimental designs should account for potential crosstalk with TNFα signaling, which enhances IGFL1 expression

• Biased signaling assessment: Based on insights from related receptors, experiments should consider the possibility of biased signaling through β-arrestin pathways

What approaches can be used to study the role of IGFL1 in T cell biology, given the expression of IGFLR1 on T cells?

Given the expression of IGFLR1 on T cells, several specialized approaches can be employed to study IGFL1's role in T cell biology:

• T cell isolation and characterization:

  • Isolate T cells from murine spleens and lymph nodes

  • Use anti-mouse IGFLR1 antibodies with anti-mouse IgG1-PE-labeled secondary antibodies for flow cytometric analysis

  • Block non-specific binding with anti-Fc receptor antibodies

• Recombinant protein stimulation studies:

  • Treat isolated T cells with purified recombinant IGFL1

  • Assess changes in:

    • T cell proliferation (CFSE dilution assays)

    • Cytokine production (ELISA or intracellular cytokine staining)

    • Activation markers (CD25, CD69 by flow cytometry)

    • Migration/chemotaxis (transwell assays)

• Competitive binding studies:

  • Use recombinant His-tagged IGFLR1 to compete with cell-surface IGFLR1 for IGFL1 binding

  • This approach helps establish binding specificity

• In vivo models:

  • Assess T cell responses in skin inflammation models in mice with varying levels of IGFL1 expression

  • Compare wild-type mice with those having genetic alterations in IGFL1 or IGFLR1

• Co-culture systems:

  • Establish co-cultures of keratinocytes (which produce IGFL1, especially when stimulated with TNFα) and T cells

  • Analyze T cell responses in this more physiologically relevant setting

These approaches can help elucidate the functional significance of the IGFL1-IGFLR1 axis in T cell biology, particularly in contexts relevant to inflammatory skin conditions.

What are common technical challenges when using IGFL1 antibodies, and how can they be addressed?

Researchers working with IGFL1 antibodies may encounter several technical challenges:

How can researchers distinguish between the different members of the IGFL family (IGFL1-4) in experimental settings?

Distinguishing between the four members of the human IGFL family (IGFL1-4) requires careful experimental design:

• RNA-level discrimination:

  • Use member-specific primer/probe sets for RT-PCR as described in previous studies

  • Design primers targeting unique regions of each family member to avoid cross-amplification

  • Validate primer specificity using recombinant plasmids containing each IGFL family member

• Protein-level discrimination:

  • Select antibodies raised against unique epitopes of each family member

  • Validate antibody specificity using recombinant proteins of all four family members

  • Consider using epitope-tagged recombinant proteins when studying overexpression systems

• Expression pattern analysis:

  • Leverage the distinct tissue expression patterns of different IGFL family members

  • IGFL1 is primarily expressed in fetal skin, normal mammary gland, ovary, and spinal cord

  • Other family members have different expression profiles that can aid in discrimination

• Receptor binding studies:

  • Examine differential binding to IGFLR1 or other potential receptors

  • Binding competition assays with purified proteins can help determine specificity

• Genetic approaches:

  • Use siRNA or CRISPR-based approaches targeting specific family members

  • Validate knockdown/knockout specificity at both RNA and protein levels

A combination of these approaches provides the most reliable discrimination between IGFL family members in experimental settings.

What is the potential significance of biased agonism in IGFL1-IGFLR1 signaling based on findings from related receptor systems?

Recent research on related receptor systems, particularly IGF-1R, suggests that biased agonism may be an important concept for understanding IGFL1-IGFLR1 signaling:

• Paradigm shift in receptor signaling:

  • Traditional models describe receptors as simply "on" or "off"

  • Emerging evidence suggests receptors can exhibit "biased signaling" where different ligands or antibodies can preferentially activate distinct downstream pathways

• β-arrestin-mediated signaling in related receptors:

  • Studies of anti-IGF-1R antibodies revealed that they can act as "biased agonists" that induce β-arrestin1 association with the receptor

  • This leads to both receptor down-regulation and β-arrestin1-dependent ERK signaling activation

  • Given structural similarities between IGFLR1 and TNF receptors, similar mechanisms might exist

• Potential implications for IGFL1-IGFLR1:

  • IGFLR1, with its structural similarity to TNFR family members, may exhibit biased signaling

  • Different ligands or antibodies targeting IGFLR1 might preferentially activate distinct pathways

  • This could explain context-dependent effects of IGFL1 in different tissues or disease states

• Experimental approaches to investigate biased signaling:

  • Compare signaling outcomes using different readouts (e.g., MAPK activation, receptor internalization)

  • Assess the role of scaffold proteins like β-arrestins in IGFLR1 signaling

  • Utilize phosphoproteomic approaches to broadly characterize signaling outcomes

  • Compare effects of natural ligand (IGFL1) with antibodies targeting IGFLR1

Understanding biased signaling in IGFL1-IGFLR1 interactions could have significant implications for developing more selective therapeutic approaches targeting this pathway.

How might the IGFL1-IGFLR1 axis interact with other established inflammatory pathways in skin disorders and cancer?

The IGFL1-IGFLR1 axis likely interacts with several established inflammatory and oncogenic pathways:

• TNFα signaling pathway:

  • TNFα enhances IGFL1 expression in keratinocytes

  • This suggests a feed-forward loop where TNFα-induced inflammation upregulates IGFL1, which may further modulate inflammatory responses via IGFLR1 on T cells

  • This interaction may be particularly relevant in psoriasis pathogenesis

• T cell activation pathways:

  • Given IGFLR1 expression on T cells, IGFL1 may modulate T cell activation, proliferation, or cytokine production

  • This could influence Th1/Th17 responses that are central to many inflammatory skin conditions

  • Experimental approaches should investigate effects on TCR signaling, co-stimulatory pathways, and cytokine production

• KLF5-mediated transcriptional networks:

  • In basal-like breast cancer, KLF5 induces lncRNA IGFL2-AS1, which upregulates IGFL1 expression

  • This represents a transcriptional regulatory network that may be active in other contexts

  • Investigating KLF5 and related transcription factors could reveal broader regulatory networks

• MAPK/ERK signaling:

  • Studies on related receptors suggest involvement of ERK signaling downstream of receptor activation

  • ERK signaling is central to numerous cellular processes including proliferation and survival

  • Combined inhibition of IGFL1-IGFLR1 and MAPK pathways might provide synergistic therapeutic effects

• Potential for immune checkpoint-like functions:

  • Given its expression on T cells and structural similarity to TNFR family members (which include co-stimulatory and co-inhibitory receptors), IGFLR1 might function as an immune checkpoint molecule

  • This could have significant implications for cancer immunotherapy approaches

Understanding these interactions will require integrated experimental approaches combining in vitro mechanistic studies with in vivo models of inflammation and cancer.

What are the most promising research directions for understanding IGFL1 biology and its therapeutic potential?

Based on current knowledge, several promising research directions emerge:

• Comprehensive characterization of IGFL1-IGFLR1 signaling mechanisms:

  • Identify key downstream effectors and signaling pathways

  • Determine if biased signaling occurs similar to what has been observed for IGF-1R

  • Develop reporter systems to monitor pathway activation

• Role in T cell biology:

  • Define the functional consequences of IGFL1-IGFLR1 interaction on various T cell subsets

  • Determine effects on T cell differentiation, cytokine production, and migration

  • Explore potential immunomodulatory applications

• Development of selective modulators:

  • Design agonists and antagonists of IGFL1-IGFLR1 interaction

  • Explore antibody-based approaches similar to those developed for IGF-1R

  • Consider biased ligands that selectively activate beneficial signaling pathways

• Expanded disease association studies:

  • Systematically evaluate IGFL1 expression across a broader range of inflammatory conditions and cancer types

  • Determine if IGFL1 could serve as a biomarker for disease progression or treatment response

  • Investigate genetic variations in IGFL1/IGFLR1 and their association with disease susceptibility

• Translational research:

  • Develop and validate IGFL1-targeting approaches in preclinical models of inflammatory skin diseases and cancer

  • Explore combination therapies, particularly with established agents targeting TNFα or MAPK pathways

  • Identify patient populations most likely to benefit from IGFL1-targeted interventions

These research directions hold promise for advancing our understanding of IGFL1 biology and potentially developing novel therapeutic approaches for inflammatory diseases and cancer.

What methodological advances are needed to better characterize the IGFL1-IGFLR1 signaling network?

To better characterize the IGFL1-IGFLR1 signaling network, several methodological advances are needed:

• Improved reagents and tools:

  • Development of more specific and sensitive antibodies against different epitopes of IGFL1 and IGFLR1

  • Generation of reporter cell lines to monitor IGFLR1 activation

  • Creation of conditional knockout models for both IGFL1 and IGFLR1

• Advanced structural biology approaches:

  • Determination of the crystal or cryo-EM structure of IGFL1-IGFLR1 complexes

  • Structure-based design of selective modulators

  • Molecular dynamics simulations to understand conformational changes upon binding

• High-throughput signaling analysis:

  • Phosphoproteomic profiling to comprehensively map signaling networks activated by IGFL1-IGFLR1

  • Single-cell analysis to address heterogeneity in responses

  • Temporal analysis of signaling dynamics using biosensors

• Systems biology integration:

  • Network analysis incorporating IGFL1-IGFLR1 signaling with other inflammatory and growth factor pathways

  • Mathematical modeling to predict pathway interactions and therapeutic responses

  • Multi-omics approaches integrating transcriptomic, proteomic, and metabolomic data

• Translational methodologies:

  • Development of biomarker assays for IGFL1 pathway activation in patient samples

  • Patient-derived organoid models to test IGFL1-targeted therapies

  • PET imaging approaches using labeled IGFL1 or anti-IGFLR1 antibodies to assess receptor expression in vivo