ikzf5 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to IKZF5 Antibody

The IKZF5 antibody is a polyclonal or monoclonal immunoglobulin designed to detect the transcription factor IKZF5 (Ikaros family zinc finger 5), a key regulator of megakaryocyte differentiation and platelet production. IKZF5 binds DNA sequences containing the core motif 5'-GNNTGTNG-3', playing a critical role in hematopoiesis . Mutations in IKZF5 are linked to autosomal dominant thrombocytopenia and α-granule deficiency in platelets . The antibody is widely used in research to study transcriptional regulation, platelet biology, and genetic disorders affecting blood cells.

Antibody Types and Applications

IKZF5 antibodies are available in multiple formats, optimized for specific experimental techniques:

SourceReactivityApplicationsImmunogen
Bio-Techne Human, Mouse, RatWB, ICC/IF, IHCRecombinant protein (aa 84–161)
Antibodies-Online Human, Dog, Guinea PigWB, IHCSynthetic N-terminal peptide
Sigma-Aldrich HumanIF (Human Protein Atlas)Peptide (KPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVEVSLDENSGMLVDGFERTFDGK)

Key applications:

  • Western blotting to detect IKZF5 protein in lysates (e.g., HEK293 cells overexpressing IKZF5 ).

  • Immunofluorescence to localize IKZF5 in nuclear regions of cells (e.g., U-2 OS cells ).

  • Immunohistochemistry for tissue-specific studies (e.g., megakaryocytes in bone marrow) .

Thrombocytopenia Studies

Mutations in IKZF5 zinc fingers disrupt DNA binding and chromatin localization, leading to reduced platelet count and α-granule formation . Key findings from genetic and biochemical studies:

Mutation TypeEffect on IKZF5 FunctionPhenotype
Missense (Y89C, R96W, G134E, C140R, H155Y)Impaired DNA binding, cytosolic retentionThrombocytopenia, α-granule deficiency
Wild-typeNuclear localization, chromatin bindingNormal platelet production

Expression Patterns

IKZF5 is expressed across hematopoietic lineages, but its misregulation specifically impacts megakaryocytes . RNA-seq data from platelets of IKZF5 mutation carriers revealed 1,194 differentially expressed genes, while other blood cells showed minimal changes .

Future Directions

The IKZF5 antibody remains critical for advancing research into:

  1. Therapeutic targeting of transcriptional regulators in platelet disorders.

  2. Epigenetic studies of megakaryocyte differentiation.

  3. Biomarker discovery for thrombocytopenia diagnostics .

Product Specs

Buffer
**Preservative:** 0.03% Proclin 300
**Constituents:** 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
ikzf5 antibody; zgc:92405Zinc finger protein Pegasus antibody; Ikaros family zinc finger protein 5 antibody
Target Names
ikzf5
Uniprot No.

Target Background

Function
IKZF5 is a DNA-binding protein that binds to the 5'GNNTGTNG-3' core sequence. It functions as a transcriptional repressor.
Gene References Into Functions
  1. IKZF5 has been implicated in left-right asymmetry. Notably, the promoter region of the Pitx2 gene, which is involved in this process, contains 'atypical' Pegasus binding sites. PMID: 23499657
Database Links
Protein Families
Ikaros C2H2-type zinc-finger protein family
Subcellular Location
Nucleus.

Q&A

What is IKZF5 and why is it important in hematological research?

IKZF5 (IKAROS Family Zinc Finger 5), also known as Pegasus, is a zinc finger transcription factor belonging to the IKAROS family of proteins. This family includes five members named after mythological figures: IKZF1 (Ikaros), IKZF2 (Helios), IKZF3 (Aiolos), IKZF4 (Eos), and IKZF5 (Pegasus) . While IKZF1, IKZF2, and IKZF3 are known to be involved in lymphocyte development, recent research has established IKZF5 as a key transcriptional regulator specifically in megakaryocytopoiesis (platelet production) . Its importance was highlighted by the discovery of pathogenic missense mutations in the IKZF5 gene associated with inherited thrombocytopenia in multiple pedigrees . Understanding IKZF5 function has become essential for advancing our knowledge of platelet disorders and potential therapeutic targets in hematological diseases.

What types of IKZF5 antibodies are available for research applications?

Several types of IKZF5 antibodies are currently available for research purposes. These include:

  • Polyclonal antibodies: Typically raised in rabbits against specific IKZF5 epitopes, such as the N-terminal region .

  • Monoclonal antibodies: More specific antibodies like the mouse monoclonal 1B6 antibody that targets amino acids 2-100 of IKZF5 .

  • Unconjugated antibodies: Most commercially available IKZF5 antibodies are unconjugated, allowing researchers flexibility in detection methods .

These antibodies vary in their reactivity across species, with many showing cross-reactivity to human, mouse, dog, rat, and other species' IKZF5 proteins, making them versatile tools for comparative studies . Selection should be based on the specific application needs and target species in your research design.

What are the common applications for IKZF5 antibodies in laboratory research?

IKZF5 antibodies are utilized in several key laboratory techniques:

  • Western Blotting (WB): For detecting and quantifying IKZF5 protein levels in cell or tissue lysates, typically using dilutions between 1:500-2000 .

  • Immunohistochemistry (IHC): For visualizing IKZF5 expression patterns in tissue sections .

  • ELISA (Enzyme-Linked Immunosorbent Assay): For quantitative measurement of IKZF5 in solution .

These applications allow researchers to investigate IKZF5 expression patterns, protein levels, and localization in various experimental contexts. When selecting an antibody, confirm its validation for your specific application and consider factors such as species reactivity, epitope specificity, and recommended working dilutions to ensure optimal experimental results .

What is the cellular localization of IKZF5 and how does this impact antibody selection?

IKZF5 is primarily localized in the nucleus, consistent with its function as a transcription factor . This nuclear localization is important to consider when designing experiments and selecting appropriate antibodies. When performing immunofluorescence or immunohistochemistry, nuclear staining patterns should be expected, and proper nuclear permeabilization protocols are essential for antibody access to the target protein. For subcellular fractionation experiments, nuclear extraction protocols should be optimized to effectively isolate IKZF5. Additionally, when selecting antibodies, those validated for detecting nuclear proteins with demonstrated specificity for IKZF5 should be prioritized to ensure accurate experimental results and minimize background staining in cytoplasmic regions .

How can IKZF5 antibodies be used to investigate thrombocytopenia mechanisms?

IKZF5 antibodies provide valuable tools for investigating the molecular mechanisms underlying IKZF5-associated thrombocytopenia. Researchers can design experiments focusing on several approaches:

  • Comparative protein expression analysis: Using Western blotting with IKZF5 antibodies to compare expression levels and potential modifications between normal and thrombocytopenia patient samples .

  • Chromatin immunoprecipitation (ChIP): Employing IKZF5 antibodies for ChIP assays to identify direct genomic binding sites and target genes affected by IKZF5 mutations in megakaryocytes.

  • Co-immunoprecipitation: Using IKZF5 antibodies to investigate protein-protein interactions that may be disrupted in thrombocytopenia patients.

  • Immunohistochemical analysis: Examining bone marrow samples from patients with IKZF5 mutations to evaluate megakaryocyte morphology and maturation status .

Studies have shown that IKZF5 mutations are highly specific to the megakaryocytic lineage, with RNA sequencing revealing that almost 10% of expressed RNAs in platelets were abnormally regulated in IKZF5-mutated individuals, compared to just 4 RNAs in other blood cell types . This lineage specificity explains why IKZF5 mutations result in isolated thrombocytopenia without affecting other hematopoietic cells, making it a unique model for studying platelet-specific transcriptional regulation.

What are the optimal conditions for Western blotting with IKZF5 antibodies?

For optimal Western blotting results with IKZF5 antibodies, the following protocol considerations are recommended:

  • Sample preparation:

    • For nuclear proteins like IKZF5, use specialized nuclear extraction buffers

    • Include protease inhibitors to prevent degradation

    • Ensure samples are fresh or properly stored at -80°C

  • Gel parameters:

    • Use 10-12% SDS-PAGE gels for optimal resolution of IKZF5 (MW: approximately 46kD)

    • Load 20-40 μg of total protein per lane

  • Transfer and detection:

    • PVDF membranes are recommended for nuclear transcription factors

    • Recommended antibody dilutions: 1:500-1:2000 depending on the specific antibody

    • Blocking: 5% non-fat dry milk or BSA in TBST for 1 hour at room temperature

    • Primary antibody incubation: Overnight at 4°C

    • Secondary antibody: Anti-rabbit or anti-mouse HRP conjugate (depending on primary)

  • Controls:

    • Positive control: Tissue/cells known to express IKZF5 (lymphoid tissues)

    • Negative control: Tissues with minimal IKZF5 expression

    • Loading control: Nuclear protein markers like Lamin B

Troubleshooting nonspecific bands often requires optimization of antibody concentration and blocking conditions. Alternative fixation methods may be necessary if standard protocols yield poor results .

How can researchers validate the specificity of IKZF5 antibodies in their experimental systems?

Validating antibody specificity is critical for accurate interpretation of IKZF5-related experiments. A comprehensive validation approach includes:

  • Knockout/knockdown validation:

    • Compare IKZF5 antibody signal in wild-type versus IKZF5 knockout/knockdown cells

    • Use siRNA or CRISPR-Cas9 technology to generate IKZF5-depleted controls

  • Peptide competition assay:

    • Pre-incubate the antibody with the immunizing peptide (when available)

    • A specific antibody will show reduced or eliminated signal after peptide blocking

  • Cross-reactivity assessment:

    • Test reactivity against other IKAROS family members (IKZF1-4)

    • Evaluate species cross-reactivity if working with animal models

  • Multiple antibody comparison:

    • Use antibodies targeting different epitopes of IKZF5

    • Consistent results across different antibodies increase confidence in specificity

  • Recombinant protein controls:

    • Use purified recombinant IKZF5 as a positive control

    • Test antibody detection limits with a concentration gradient

For the polyclonal antibody derived from the human IKZF5 AA range 210-260, researchers should be particularly vigilant about cross-reactivity with other IKAROS family members due to potential sequence homology . Performing careful validation ensures that experimental observations can be confidently attributed to IKZF5 specifically.

What approaches can be used to investigate IKZF5 interactions with other transcription factors?

To study IKZF5 interactions with other transcription factors, researchers can employ several sophisticated approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use IKZF5 antibodies to pull down protein complexes, followed by Western blotting for potential binding partners

    • Reverse Co-IP (using antibodies against suspected binding partners) can confirm interactions

  • Proximity Ligation Assay (PLA):

    • Visualize protein-protein interactions in situ using IKZF5 antibodies paired with antibodies against potential interacting partners

    • Provides spatial information about where in the nucleus interactions occur

  • ChIP-sequencing and Re-ChIP:

    • Perform ChIP-seq with IKZF5 antibodies to identify genomic binding sites

    • Follow with Re-ChIP using antibodies against other transcription factors to identify co-occupied regions

  • RIME (Rapid Immunoprecipitation Mass spectrometry of Endogenous proteins):

    • Combine immunoprecipitation with mass spectrometry to identify novel IKZF5 interactors

    • Particularly useful for discovering previously unknown protein associations

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion proteins of IKZF5 and potential partners with split fluorescent protein fragments

    • Interaction brings fragments together, generating fluorescence

These approaches can help elucidate how IKZF5 functions within transcriptional complexes to regulate megakaryocytopoiesis and platelet production . Understanding these interactions may provide insights into the molecular mechanisms underlying IKZF5-associated thrombocytopenia and potential therapeutic targets.

What are common challenges when using IKZF5 antibodies in immunohistochemistry and how can they be addressed?

Researchers frequently encounter several challenges when using IKZF5 antibodies for immunohistochemistry:

  • High background staining:

    • Optimize blocking conditions (try 5-10% normal serum from the secondary antibody species)

    • Increase washing duration and frequency (3-5 washes of 5-10 minutes each)

    • Reduce primary antibody concentration (test dilutions from 1:100 to 1:1000)

    • Use more specific secondary antibodies with minimal cross-reactivity

  • Weak or absent signal:

    • Optimize antigen retrieval methods (test both heat-induced and enzymatic methods)

    • Extend primary antibody incubation time (overnight at 4°C)

    • Use signal amplification systems (biotin-streptavidin or tyramide signal amplification)

    • Ensure tissue fixation is appropriate (overfixation can mask epitopes)

  • Non-specific nuclear staining:

    • Implement additional blocking steps for endogenous peroxidase and biotin

    • Use more stringent washing conditions with detergents

    • Consider competitive blocking with immunizing peptide controls

  • Tissue-specific optimization:

    • Different tissues may require adjusted fixation times

    • Bone marrow samples may need specialized decalcification protocols that preserve epitopes

Since IKZF5 is a nuclear transcription factor, ensuring proper nuclear permeabilization while maintaining tissue morphology is critical . Testing multiple antibody clones or epitope targets may be necessary to identify the optimal reagent for specific tissue types or fixation methods.

How can researchers optimize IKZF5 antibody use for studying rare cell populations like megakaryocytes?

Studying IKZF5 in rare cell populations like megakaryocytes presents unique challenges that require specialized approaches:

  • Enrichment strategies:

    • Use magnetic bead separation with megakaryocyte markers (CD41/CD61)

    • Implement density gradient centrifugation to isolate larger cells

    • Consider laser capture microdissection for tissue samples

  • Flow cytometry optimization:

    • Combine IKZF5 antibody with megakaryocyte-specific surface markers

    • Use intracellular staining protocols optimized for nuclear proteins

    • Increase total events collected (≥500,000) to capture sufficient rare cells

  • Immunofluorescence approaches:

    • Implement multi-color staining with lineage-specific markers alongside IKZF5

    • Use confocal microscopy for improved signal resolution

    • Apply deconvolution algorithms to enhance nuclear signal detection

  • Single-cell analysis:

    • Combine IKZF5 antibody staining with single-cell RNA-seq

    • Consider index sorting to correlate protein expression with transcriptional profiles

Given the lineage-specific role of IKZF5 in megakaryocytopoiesis revealed by Lentaigne et al., these specialized approaches are essential for understanding its function in normal and pathological platelet production . Clinical samples from patients with IKZF5 mutations provide valuable models for studying the protein's role in thrombocytopenia, though they require careful handling and optimization of antibody conditions for limited material.

What considerations should researchers make when designing IKZF5 ChIP-seq experiments?

Chromatin immunoprecipitation followed by sequencing (ChIP-seq) for IKZF5 requires careful consideration of several factors:

  • Antibody selection:

    • Choose antibodies validated specifically for ChIP applications

    • Consider using multiple antibodies targeting different IKZF5 epitopes

    • Validate antibody performance using known IKZF5 target regions

  • Crosslinking and chromatin preparation:

    • For transcription factors like IKZF5, standard 1% formaldehyde crosslinking for 10 minutes is typically sufficient

    • Optimize sonication conditions to achieve chromatin fragments of 200-500bp

    • Verify fragmentation by agarose gel electrophoresis

  • Cell number and sample handling:

    • For rare cell populations like megakaryocytes, adapt protocols for low cell numbers (10^4-10^5 cells)

    • Consider native ChIP approaches that don't require crosslinking for very limited samples

    • Implement carrier chromatin strategies if working with extremely small samples

  • Control samples:

    • Include input controls (non-immunoprecipitated chromatin)

    • Use IgG control immunoprecipitations as negative controls

    • Consider spike-in normalization with foreign chromatin (e.g., Drosophila)

  • Data analysis considerations:

    • Compare IKZF5 binding sites with other IKAROS family members to identify unique vs. shared targets

    • Integrate with RNA-seq data to correlate binding with gene expression changes

    • Look specifically at genes associated with megakaryocyte differentiation and platelet production

Given that IKZF5 mutations affect ~10% of expressed RNAs in platelets while having minimal impact on other blood cell types, ChIP-seq analysis should focus on megakaryocyte-specific regulatory elements and genes implicated in thrombocytopoiesis . This approach will help elucidate the specific transcriptional networks regulated by IKZF5 in normal and pathological conditions.

How can IKZF5 antibodies be used to investigate thrombocytopenia biomarkers?

IKZF5 antibodies offer promising tools for developing biomarkers related to inherited thrombocytopenia:

  • Diagnostic applications:

    • Immunophenotyping of bone marrow samples to detect IKZF5 protein abnormalities

    • Flow cytometry panels incorporating IKZF5 antibodies to identify platelet defects

    • Immunohistochemical staining of bone marrow biopsies to assess megakaryocyte development

  • Biomarker development strategy:

    • Compare IKZF5 protein expression patterns between healthy individuals and thrombocytopenia patients

    • Correlate IKZF5 levels or localization abnormalities with clinical parameters

    • Develop standardized scoring systems for IKZF5 immunostaining patterns

  • Combined biomarker approaches:

    • Pair IKZF5 protein analysis with platelet transcriptome profiling

    • Integrate with other known thrombocytopenia markers for multiparameter analysis

    • Correlate IKZF5 binding patterns with downstream gene expression changes

The high specificity of IKZF5 for megakaryocyte lineage makes it particularly valuable as a biomarker candidate . Unlike other transcription factor mutations that cause broader hematopoietic abnormalities, IKZF5 mutations result in isolated thrombocytopenia, suggesting that altered IKZF5 protein patterns could serve as specific diagnostic indicators for this subtype of inherited platelet disorders .

What potential exists for studying IKZF5 in relation to other IKAROS family members?

The study of IKZF5 in relation to other IKAROS family members offers significant research opportunities:

  • Comparative binding pattern analysis:

    • Use ChIP-seq with antibodies against different IKAROS proteins to map genomic binding sites

    • Identify unique vs. overlapping regulatory regions between family members

    • Determine if IKZF5 competes with or cooperates with other IKAROS proteins

  • Protein-protein interaction studies:

    • Investigate potential heterodimerization between IKZF5 and other family members

    • Map interaction domains using truncated protein constructs

    • Determine if pathogenic IKZF5 mutations affect these interactions

  • Lineage-specific regulation:

    • Compare expression patterns of all IKAROS family members across hematopoietic lineages

    • Examine how IKZF5 specifically regulates megakaryocytopoiesis while other members control lymphocyte development

    • Investigate potential compensatory mechanisms among family members

  • Evolutionary comparative analysis:

    • Use antibodies with cross-species reactivity to study IKZF5 conservation

    • Compare IKZF5 function between species with antibodies reactive to human, mouse, rat, and other organisms

While IKZF1, IKZF2, and IKZF3 are primarily associated with lymphocyte development and hematologic malignancies, IKZF5's specialized role in megakaryocyte development represents a distinct evolutionary specialization within this transcription factor family . Understanding how this functional divergence occurred could provide insights into transcription factor evolution and lineage specification in hematopoiesis.

How might IKZF5 antibodies contribute to therapeutic development for thrombocytopenia disorders?

IKZF5 antibodies have potential applications in therapeutic development for thrombocytopenia disorders through several research avenues:

  • Drug screening and validation:

    • Use IKZF5 antibodies to monitor protein levels/activity in response to candidate compounds

    • Develop cell-based assays with IKZF5 immunodetection as readouts for high-throughput screening

    • Validate target engagement of compounds designed to modulate IKZF5 activity

  • Ex vivo megakaryocyte culture systems:

    • Employ IKZF5 antibodies to track differentiation in patient-derived megakaryocyte cultures

    • Monitor therapeutic responses in personalized medicine approaches

    • Evaluate IKZF5 localization and binding pattern changes in response to treatments

  • Therapeutic target identification:

    • Use IKZF5 antibodies in ChIP-seq to identify downstream genes as potential therapeutic targets

    • Map the IKZF5 regulatory network to find intervention points that bypass mutated IKZF5

    • Study protein interactions to identify cofactors that might be more druggable than IKZF5 itself

  • Monitoring therapy effectiveness:

    • Develop IKZF5 antibody-based assays to track restoration of normal megakaryocyte development

    • Create companion diagnostic tools to identify patients likely to respond to specific therapies

The favorable clinical profile of IKZF5-associated thrombocytopenia (mild bleeding tendency, absence of leukemia predisposition) makes it an attractive target for therapeutic development compared to other transcription factor-related thrombocytopenias like those associated with RUNX1 and ETV6 mutations, which carry leukemia risks . This creates opportunities for developing targeted therapies with potentially fewer concerns about unintended consequences.

What bioinformatic approaches can complement IKZF5 antibody experiments in research?

Bioinformatic approaches can significantly enhance IKZF5 antibody-based experimental data:

  • Integrated multi-omics analysis:

    • Combine ChIP-seq data (using IKZF5 antibodies) with RNA-seq to correlate binding with expression

    • Integrate proteomics data from IKZF5 immunoprecipitation with transcriptomic profiles

    • Develop network models incorporating IKZF5 binding, expression changes, and protein interactions

  • Machine learning applications:

    • Train algorithms to identify IKZF5 binding motifs from ChIP-seq data

    • Use predictive modeling to identify potential IKZF5 target genes in different cell types

    • Develop classifiers to distinguish IKZF5-related thrombocytopenia from other forms

  • Comparative genomics approaches:

    • Use algorithms like ESTIMATE to evaluate immune infiltration conditions

    • Employ CIBERSORT for characterizing cellular composition based on gene expression profiles

    • Analyze single-cell RNA-seq data using tools like TISCH to examine IKZF5 expression patterns across cell types

  • Mutation impact prediction:

    • Structural modeling of IKZF5 to predict how mutations affect DNA binding

    • Simulate the effects of identified mutations on protein stability and interactions

    • Predict differential binding patterns of wild-type vs. mutant IKZF5

  • Drug response correlation:

    • Use databases like cellminer to correlate IKZF5 expression with drug sensitivity profiles

    • Identify compounds that might modulate IKZF5 activity or bypass IKZF5 mutations

These bioinformatic approaches can help interpret complex data generated by IKZF5 antibody experiments and identify new research directions or therapeutic opportunities that might not be obvious from experimental data alone.

Comparison of available IKZF5 antibodies and their validated applications

Antibody IDHostClonalityTarget RegionValidated ApplicationsSpecies ReactivityRecommended Dilutions
ABIN2777834RabbitPolyclonalN-TermWB, IHCHuman, Mouse, Dog, Rat, Cow, Guinea Pig, Horse, Rabbit, ZebrafishWB: 1:500-1000, IHC: 1:100-500
ES15491RabbitPolyclonalAA 210-260WBHuman, MouseWB: 1:500-2000
UnknownMouseMonoclonal (1B6)AA 2-100WB, ELISAHumanWB: 1:500-1000, ELISA: 1:1000-5000
UnknownRabbitPolyclonalC-TermWB, IHC, ELISAHuman, Mouse, Dog, RatWB: 1:500-1000, IHC: 1:50-200, ELISA: 1:1000

Note: This table compiles information from multiple sources to provide a comprehensive comparison of commercially available IKZF5 antibodies. Selection should be based on the specific application and experimental design requirements .

IKZF5 molecular characteristics relevant to antibody-based detection

ParameterDescriptionRelevance to Antibody Applications
Molecular Weight~46 kDaCritical for Western blot band identification
Gene ID64376Useful for confirming target specificity
Human Swiss-Prot NoQ9H5V7Reference for sequence verification
Cellular LocalizationNucleusDetermines appropriate sample preparation methods
N-terminal SequenceMGEKKPEPLD FVKDFQEYLT QQTHHVNMIS GSVSGDKEAE ALQGAGTDGDTarget region for some antibodies
Predicted Species HomologyHuman: 100%, Mouse: 100%, Rat: 100%, Dog: 100%, Cow: 100%, Zebrafish: 93%Explains cross-reactivity patterns
Protein FamilyIKAROS family of zinc finger transcription factorsImportant for specificity testing against related proteins

This data provides essential information for experimental design and interpretation when working with IKZF5 antibodies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.