INHBE Antibody

What is the INHBE protein and what are its known biological functions?

INHBE encodes the Activin beta-E chain, a member of the TGF-β superfamily of proteins. Research indicates that hepatic Activin E (the protein product of INHBE) mediates liver-adipose tissue communication and plays a significant role in metabolic regulation. Studies have shown that hepatic INHBE expression increases during fasting and following CL 316,243 treatment in mice, suggesting its involvement in metabolic challenges . Functionally, Activin E has been demonstrated to suppress isoproterenol-stimulated non-esterified fatty acid (NEFA) release in adipocytes in a concentration-dependent manner, indicating its role in regulating lipolysis .

What applications are INHBE antibodies validated for in research settings?

INHBE antibodies have been validated for multiple research applications:

These applications enable researchers to detect and quantify INHBE protein expression across different experimental contexts . When selecting an antibody, researchers should consider the specific validation data available for their intended application and sample type.

How should INHBE antibodies be stored and handled to maintain optimal activity?

Proper storage and handling are critical for maintaining antibody functionality. INHBE antibodies are typically stored in buffered aqueous glycerol solution at -20°C . Most commercial INHBE antibodies remain stable for one year after shipment when properly stored. For the Proteintech antibody (15405-1-AP), aliquoting is unnecessary for -20°C storage, which can simplify laboratory workflows .

When handling these antibodies:

• Avoid repeated freeze-thaw cycles

• Store in recommended buffer conditions (e.g., PBS with 0.02% sodium azide and 50% glycerol at pH 7.3)

• Follow manufacturer guidelines for thawing procedures

• Consider that some preparations contain BSA (0.1%) which may affect certain applications

How can researchers validate the specificity of their INHBE antibody?

Validating antibody specificity is crucial for reliable research outcomes. For INHBE antibodies, several validation approaches are recommended:

• Orthogonal validation: Compare protein expression results with RNAseq data. The Prestige Antibodies line from Sigma-Aldrich utilizes enhanced validation through orthogonal RNAseq, providing greater confidence in antibody specificity .

• Immunodepletion experiments: As demonstrated in research on Activin E's role in adipocyte lipolysis, immunological depletion can confirm antibody specificity. In one study, immunoadsorption of mouse INHBE conditioned media reduced INHBE peptide by over 40% relative to IgG controls, and this reduction corresponded to diminished biological activity .

• Cross-reactivity testing: Evaluate antibody performance across species. While some antibodies may recognize human INHBE, they might not recognize mouse INHBE efficiently, as observed in immunoadsorption experiments where an antibody effectively depleted mouse but not human Activin E .

• Knockout/knockdown controls: Use samples with genetic knockdown or knockout of INHBE to confirm signal specificity.

What are the optimal experimental conditions for using INHBE antibodies in adipose tissue research?

Given Activin E's role in liver-adipose communication, researchers investigating this axis should consider:

• Experimental models: Mouse brown adipocytes (mBAds) have been successfully used to study Activin E's effects on lipolysis. When treating mBAds with INHBE-conditioned media, a concentration-dependent suppression of isoproterenol-stimulated NEFA release was observed .

• Conditioned media preparation: When purified Activin E is unavailable, researchers can prepare INHBE-conditioned media by transfecting cell lines (e.g., Expi293F embryonic kidney cells) with plasmids encoding mouse or human INHBE, harvesting media 96 hours post-transfection .

• Control conditions: Empty vector control conditioned media is essential to distinguish specific effects of Activin E from non-specific effects of the media itself .

• Concentration considerations: A 3% final concentration of INHBE-conditioned media has been shown to result in approximately 50% suppression of NEFA release in mBAds, providing a reference point for experimental design .

How do researchers distinguish between different Activin proteins when using antibodies?

Distinguishing between Activin proteins (including Activin A, B, and E) requires careful experimental design:

• Antibody selection: Choose antibodies raised against unique epitopes. The immunogen sequence for the Sigma-Aldrich INHBE antibody (RPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAG) provides specificity for INHBE .

• Immunoadsorption controls: When studying Activin E specifically, include Activin B-containing media as a control during immunoadsorption experiments to confirm antibody specificity. Research has shown that Activin E pulldown of control conditioned media and Activin B-containing media did not affect adipocyte lipolysis, demonstrating the specificity of the Activin E pulldown procedure .

• Functional validation: Compare biological activities. For instance, while Activin E suppresses adipocyte lipolysis, other Activins may have different effects, allowing functional differentiation.

What are the emerging computational approaches for antibody research that might benefit INHBE studies?

Recent computational advances may enhance INHBE antibody development and applications:

• Equivariant graph translation: The Multi-channel Equivariant Attention Network (MEAN) approach formulates antibody design as a conditional graph translation problem, capturing 3D geometrical correlations between different components. This method has shown a 23% improvement in antigen-binding CDR design and 34% improvement for affinity optimization compared to baseline methods .

• Co-design of 1D sequences and 3D structures: Rather than focusing solely on antibody sequence, newer computational approaches co-design 1D sequences and 3D structures of Complementarity-Determining Regions (CDRs), potentially improving antibody-antigen interactions .

• Multi-round progressive full-shot scheme: This approach outputs both sequence and structure information with greater efficiency and precision compared to previous autoregressive approaches, which could benefit future INHBE antibody development .

What is the recommended protocol for Western blot analysis using INHBE antibodies?

For optimal Western blot results with INHBE antibodies:

• Sample preparation: Mouse liver tissue has been demonstrated as a positive control for INHBE expression .

• Antibody dilution: Use a dilution range of 1:500-1:1000 for Western blot applications, though optimization for specific experimental conditions is recommended .

• Expected molecular weight: The calculated molecular weight of INHBE is approximately 39 kDa, which should be the target band size in Western blot analysis .

• Controls: Include both positive controls (known INHBE-expressing tissues like liver) and negative controls to validate results.

• Blocking conditions: Follow manufacturer-specific protocols, as blocking conditions can significantly impact antibody performance and background signals.

How can researchers effectively use INHBE antibodies in immunohistochemistry applications?

For immunohistochemistry applications:

• Dilution range: Use a dilution of 1:200-1:500 as a starting point, optimizing based on signal intensity and background .

• Tissue types: INHBE antibodies have been validated in various human tissues. Published literature indicates strong associations with liver tissue (>5 publications), embryonic tissue (>3 publications), and lower frequencies in cervix, bone marrow, and muscle (>1 publication each) .

• Disease associations: When studying pathological conditions, consider that INHBE has documented associations with hepatocellular carcinoma and liver diseases, which may inform tissue selection and experimental design .

• Pathway context: INHBE is associated with multiple signaling pathways including Activin Signaling, Cytokine-cytokine Receptor Interaction, Glycoprotein Hormones, and Signaling Pathways Regulating Pluripotency Of Stem Cells , providing broader biological context for interpreting immunohistochemistry results.

How can researchers quantify INHBE protein levels in biological samples?

For quantitative analysis of INHBE protein:

• ELISA methodology: Commercial ELISA kits utilize a sandwich enzyme immunoassay approach. Standards or samples are added to microplate wells with biotin-conjugated antibody specific to INHBE, followed by addition of Avidin conjugated to Horseradish Peroxidase (HRP) .

• Detection method: After adding TMB substrate solution, wells containing INHBE, biotin-conjugated antibody, and enzyme-conjugated Avidin exhibit a color change. The reaction is terminated with sulfuric acid solution, and absorbance is measured at 450nm (±10nm) .

• Quantification: INHBE concentration in samples is determined by comparing sample optical density to a standard curve .

• Sample types: Human samples have been validated for INHBE detection, though careful optimization may be required for other species or unique sample types .

How is INHBE antibody research contributing to our understanding of metabolic disorders?

INHBE antibody research has revealed important insights into metabolic regulation:

• Liver-adipose communication: Studies using INHBE antibodies have demonstrated that hepatic Activin E mediates communication between liver and adipose tissue, regulating lipolysis in adipocytes .

• Fasting response: INHBE expression increases in mouse liver during fasting and following β3-adrenergic receptor activation (CL 316,243 treatment), suggesting a role in adaptive metabolic responses .

• Lipolysis suppression: Activin E specifically suppresses β-adrenergic stimulated lipolysis, as demonstrated through experiments using INHBE-conditioned media and confirmed through antibody-mediated depletion of Activin E .

• Mechanistic insights: INHBE antibodies have helped elucidate the molecular mechanisms of Activin E's effects on adipocyte metabolism, including its interaction with different lipolytic agonists such as isoproterenol and CL 316,243 .

What novel techniques are emerging for studying INHBE protein interactions?

Emerging techniques that may enhance INHBE research include:

• 3D structural analysis: Advances in computational methods for co-designing antibody 1D sequences and 3D structures could improve our understanding of INHBE-antibody interactions and facilitate development of more specific research tools .

• Multi-channel attention mechanisms: Techniques that leverage E(3)-equivariant message passing along with attention mechanisms may better capture geometrical correlations between INHBE and its binding partners, potentially revealing new functional insights .

• Integration with other omics data: Combining antibody-based protein detection with transcriptomics (as in orthogonal RNAseq validation) provides multi-level validation and more comprehensive understanding of INHBE biology .

• Improved immunodepletion techniques: Refinement of immunoadsorption methods could allow more precise manipulation of INHBE levels in experimental systems, facilitating mechanistic studies of Activin E function .