iqch Antibody

Shipped with Ice Packs
In Stock

Description

Structure and Function of IQCH Antibody

IQCH antibodies are polyclonal or monoclonal reagents raised against epitopes within the IQCH protein. The canonical IQCH isoform (IQCH-201) spans 1,027 amino acids (117.3 kDa), with expression predominantly in testicular germ cells . Antibodies are typically generated using peptide immunogens derived from conserved regions of IQCH, such as residues 406–435 (KAEAATKIQATWKSYKARSSFISYRQKKWA) .

Antibody TypeEpitope TargetApplications
PolyclonalCentral regionWestern blot, IHC
MonoclonalSpecific isoformsELISA, IP

Applications in Research

IQCH antibodies are integral to investigating:

  • Sperm motility defects: Used in western blot and immunofluorescence to detect IQCH loss in infertile patients .

  • Protein-protein interactions: Employed in co-immunoprecipitation (Co-IP) to identify IQCH-binding partners, such as calmodulin (CaM) .

  • Knockout validation: Confirms IQCH depletion in CRISPR-Cas9 mouse models .

ApplicationMethodOutcome
Western blotSDS-PAGE, CoomassieDetects IQCH isoforms in sperm
ImmunofluorescenceFluorescent microscopyLocalizes IQCH to sperm flagella
Co-IPLC-MS/MSIdentifies CaM-IQCH complexes

Validation and Specificity

Antibody performance is rigorously assessed through:

  • Western blot: Demonstrates loss of IQCH-201 in patient spermatozoa .

  • Immunoprecipitation: Confirms epitope recognition via LC-MS/MS .

  • Tissue specificity: Validated in testicular lysates and germ cell lines .

Challenges and Considerations

  • Isoform cross-reactivity: Some antibodies fail to recognize shorter isoforms (e.g., IQCH-214) .

  • Batch variability: Requires lot-to-lot validation for reproducibility .

  • Species specificity: Rabbit-derived antibodies are commonly used in human and mouse studies .

Research Findings

  • IQCH deficiency correlates with sperm axoneme defects and mitochondrial dysfunction .

  • Antibodies reveal IQCH’s role in regulating RNA-binding proteins (e.g., HNRNPA2B1) essential for spermatogenesis .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
iqch antibody; si:dkey-246a16.2 antibody; IQ motif-containing protein H antibody
Target Names
iqch
Uniprot No.

Q&A

What is IQCH and what is its biological significance?

IQCH (IQ motif-containing H) is a protein with significant roles in male reproductive processes. In humans, the canonical IQCH protein consists of 1027 amino acid residues with a molecular mass of approximately 117.3 kDa, and up to five different isoforms have been reported for this protein. IQCH is predominantly expressed in fetal and adult testis, specifically in germ cells rather than somatic cells, suggesting specialized reproductive functions. The protein contains IQ motifs which are known to bind calmodulin (CaM), a critical calcium-binding messenger protein involved in signal transduction pathways. Recent research has definitively established IQCH's essential role in spermatogenesis, as loss-of-function mutations in this gene have been directly linked to male infertility in both humans and mouse models .

IQCH is believed to function by binding to calmodulin and subsequently regulating the expression of RNA-binding proteins (particularly HNRPAB) that are indispensable for proper spermatogenesis. This regulatory pathway affects critical aspects of sperm development including flagellar structure, axoneme integrity, and mitochondrial arrangement. IQCH belongs to a small group of IQ motif-containing proteins, including IQCD, IQCF1, IQCG, and IQCN, that have been implicated in spermatogenesis, expanding our understanding of calcium-mediated signaling in reproductive processes .

What applications are anti-IQCH antibodies commonly used for in research?

Anti-IQCH antibodies serve crucial roles in multiple immunodetection techniques for studying the IQCH protein in research contexts. The most common application is ELISA (enzyme-linked immunosorbent assay), which provides quantitative measurement of IQCH protein levels in various sample types. Additionally, anti-IQCH antibodies are frequently employed in immunocytochemistry (ICC) and immunofluorescence (IF) techniques to visualize the subcellular localization of IQCH within germ cells and developing sperm cells .

Western blotting represents another significant application, allowing researchers to detect and quantify IQCH protein expression levels and determine protein size, which is particularly useful when investigating different isoforms. Immunohistochemistry, particularly on paraffin-embedded sections (IHC-p), enables the examination of IQCH distribution in tissue contexts, providing insights into its expression patterns across reproductive tract tissues. These diverse applications make anti-IQCH antibodies versatile tools for investigating the protein's expression, localization, and functional relationships in male reproductive biology research .

How should researchers select the appropriate anti-IQCH antibody for their experiments?

Selecting the appropriate anti-IQCH antibody requires careful consideration of several experimental parameters. First, researchers must determine which applications they intend to use the antibody for, as different antibodies demonstrate variable performance across techniques such as Western blotting, immunofluorescence, ELISA, or immunohistochemistry. The search results indicate that while most commercially available anti-IQCH antibodies are validated for ELISA, a smaller subset is optimized for Western blotting or immunofluorescence applications .

Second, species reactivity is a critical consideration. Researchers should select antibodies that recognize IQCH in their experimental model organism. Available anti-IQCH antibodies demonstrate reactivity with human IQCH, and some cross-react with mouse IQCH, which is important for comparative studies between human samples and mouse models. Additionally, researchers should consider the antibody format (polyclonal versus monoclonal) based on their specific requirements for specificity, batch consistency, and detection sensitivity. Polyclonal antibodies may provide higher sensitivity by recognizing multiple epitopes, while monoclonal antibodies offer greater specificity and consistency between experiments. Finally, researchers should evaluate whether conjugated antibodies (such as biotin-labeled options) might streamline their experimental workflow for detection protocols .

How can anti-IQCH antibodies be utilized to investigate spermatogenesis defects?

Anti-IQCH antibodies offer sophisticated approaches for dissecting the molecular mechanisms underlying spermatogenesis defects. Researchers can employ these antibodies in dual or triple immunofluorescence staining protocols alongside markers for specific spermatogenesis stages to characterize precisely when and where IQCH function becomes critical during germ cell development. Based on recent findings, IQCH is detectable in the cytoplasm of spermatocytes and round spermatids, and in the flagella of late spermatids, suggesting stage-specific functions that can be further dissected using well-characterized antibodies .

For investigating potential pathological mechanisms, researchers can utilize anti-IQCH antibodies to examine IQCH expression patterns in testicular biopsies from infertile males, comparing these with control samples to identify altered localization, expression levels, or post-translational modifications that might contribute to infertility. Additionally, immunoprecipitation with anti-IQCH antibodies followed by mass spectrometry can reveal IQCH-interacting proteins in testicular tissue, providing insights into the protein interaction networks governing spermatogenesis. This approach has already revealed the interaction between IQCH and calmodulin, which regulates RNA-binding proteins essential for spermatogenesis .

Furthermore, anti-IQCH antibodies can be employed in chromatin immunoprecipitation (ChIP) assays if IQCH is found to have nuclear functions, potentially identifying genomic regions regulated by IQCH during spermatogenesis. The combination of these advanced applications allows researchers to comprehensively characterize the molecular pathways through which IQCH deficiency leads to specific sperm abnormalities, including cracked flagellar axonemes and aberrant mitochondrial structures observed in both human patients and knockout mouse models .

What methodological considerations are important when using anti-IQCH antibodies for immunolocalization in reproductive tissues?

Immunolocalization of IQCH in reproductive tissues presents several methodological challenges that researchers must address to obtain reliable results. First, the fixation protocol significantly impacts epitope preservation and antibody accessibility. For testicular tissue, which contains both rigid structures (like developing flagella) and delicate cellular components, researchers should evaluate whether paraformaldehyde fixation (4%, 12-24 hours) or Bouin's solution provides optimal epitope preservation for their specific anti-IQCH antibody. Notably, findings from IQCH studies suggest that preservation of flagellar structures may require specialized fixation approaches to maintain structural integrity while allowing antibody penetration .

Antigen retrieval represents another critical consideration, particularly for paraffin-embedded tissues. Heat-induced epitope retrieval in citrate buffer (pH 6.0) has been successfully employed in IQCH studies, but researchers should empirically determine optimal conditions for their specific antibody and tissue preparation. When performing immunofluorescence on testicular sections, background autofluorescence can interfere with specific signal detection. Treatment with sodium borohydride (0.1% in PBS) before blocking or inclusion of Sudan Black B (0.1% in 70% ethanol) after secondary antibody incubation effectively reduces autofluorescence from lipofuscin pigments abundant in reproductive tissues .

For co-localization studies examining IQCH alongside other spermatogenesis markers, researchers must carefully select antibodies raised in different host species to avoid cross-reactivity. Additionally, sequential staining protocols may be necessary when investigating multiple antigens in the same tissue section. Finally, appropriate controls are essential, including both negative controls (omitting primary antibody, using isotype controls) and positive controls (tissues with confirmed IQCH expression), particularly important given the highly specialized expression pattern of IQCH in specific germ cell populations .

How do IQCH knockout models inform antibody-based detection strategies and validation approaches?

IQCH knockout models provide invaluable tools for validating antibody specificity and developing robust detection strategies. The generation of IQCH knockout mice using CRISPR-Cas9 technology, as described in recent research, creates true negative controls that are essential for unambiguous validation of anti-IQCH antibodies. When performing Western blot analyses, testicular lysates from IQCH knockout mice should produce no detectable bands at the expected molecular weight (~117.3 kDa), confirming that the signal in wild-type samples represents specific IQCH detection rather than cross-reactivity with related proteins. This validation is particularly important given that several IQ motif-containing proteins are expressed in testicular tissue .

For immunohistochemistry and immunofluorescence applications, IQCH knockout tissue sections serve as definitive negative controls that help researchers establish appropriate antibody dilutions and detection protocols that maximize specific signal while minimizing background. The availability of these knockout models enables researchers to characterize antibody performance across different applications systematically. Recent studies have shown that IQCH protein is detectable in the cytoplasm of spermatocytes and round spermatids, as well as in the flagella of late spermatids, providing clear expected localization patterns that validated antibodies should reproduce .

Additionally, IQCH knockout models facilitate the development of sandwich ELISA systems for quantitative IQCH measurements. By confirming the absence of signal in knockout samples across a concentration range, researchers can establish assay specificity and determine appropriate detection thresholds. These models also inform epitope mapping studies that can identify the most immunogenic regions of IQCH for next-generation antibody development, potentially yielding reagents with enhanced sensitivity and specificity for detecting specific IQCH isoforms or post-translationally modified variants .

What techniques are available for analyzing IQCH expression patterns during spermatogenesis?

Multiple complementary techniques enable comprehensive analysis of IQCH expression patterns throughout spermatogenesis. Quantitative real-time PCR (qPCR) provides a sensitive method for measuring IQCH mRNA expression across different tissues and developmental timepoints. Research has demonstrated that IQCH is highly expressed in mouse testis compared to other organs, with expression significantly increasing around postnatal day 21, peaking at day 35, and then stabilizing. This temporal pattern coincides with key spermatogenesis events, providing important context for protein-level studies .

Immunohistochemistry and immunofluorescence using validated anti-IQCH antibodies enable spatial resolution of IQCH protein localization within testicular sections. These techniques have revealed that IQCH exhibits similar localization patterns in human and mouse spermatogenesis, being detected mainly in the cytoplasm of spermatocytes and round spermatids, and in the flagella of late spermatids. This stage-specific localization suggests distinct functional roles during different phases of sperm development .

For higher resolution analysis, immunoelectron microscopy can localize IQCH to specific subcellular structures, which is particularly valuable given IQCH's involvement in flagellar and mitochondrial organization. Additionally, single-cell RNA sequencing of sorted testicular cell populations provides insights into cell type-specific expression patterns, potentially revealing distinct expression profiles across different spermatogenic cell types. Western blotting complements these approaches by allowing quantitative comparison of IQCH protein levels across developmental stages or between wild-type and mutant samples, while also detecting different isoforms that may have stage-specific functions .

How can researchers effectively study the interaction between IQCH and calmodulin in reproductive contexts?

Investigating the interaction between IQCH and calmodulin (CaM) in reproductive contexts requires specialized approaches that account for the unique cellular environment of developing sperm cells. Co-immunoprecipitation (Co-IP) serves as a primary method for confirming this interaction in testicular lysates. Researchers can immunoprecipitate IQCH using validated antibodies and then probe for CaM in the precipitate, or vice versa. When performing these experiments, it's crucial to consider buffer conditions carefully, as calcium concentration significantly influences CaM binding to IQ motif-containing proteins. Comparing binding in calcium-containing versus EGTA-supplemented buffers can provide insights into the calcium-dependence of this interaction .

Proximity ligation assays (PLA) offer an alternative approach for visualizing IQCH-CaM interactions directly within testicular tissue sections or isolated germ cells. This technique generates fluorescent signals only when two proteins are within 40 nm of each other, providing spatial information about where in the cell these interactions occur during different stages of spermatogenesis. For in vitro validation and detailed interaction characterization, researchers can express recombinant IQCH fragments containing the IQ motifs and perform pulldown assays with purified CaM, determining binding affinities and the specific contribution of individual IQ motifs .

Surface plasmon resonance (SPR) or microscale thermophoresis (MST) provide quantitative measurements of binding kinetics between IQCH peptides and CaM under varying calcium concentrations, yielding insights into how this interaction might be regulated during calcium signaling events in spermatogenesis. Additionally, fluorescence resonance energy transfer (FRET) approaches using fluorescently-tagged IQCH and CaM can monitor their interaction dynamics in live cells, particularly valuable for understanding how these interactions might change during different phases of sperm development or in response to physiological stimuli .

What strategies can researchers employ to investigate IQCH's role in RNA-binding protein regulation during spermatogenesis?

Investigating IQCH's role in regulating RNA-binding proteins during spermatogenesis requires multifaceted approaches combining molecular, cellular, and genetic techniques. RNA immunoprecipitation (RIP) followed by sequencing represents a powerful method for identifying RNA transcripts associated with IQCH-regulated RNA-binding proteins, particularly HNRPAB which has been implicated as a downstream effector of IQCH function. By comparing RIP-seq profiles between wild-type and IQCH knockout testicular tissues, researchers can identify specific transcripts whose processing or stability depends on IQCH-mediated regulation .

Crosslinking immunoprecipitation (CLIP) techniques provide higher resolution mapping of RNA-protein interaction sites, revealing the precise binding locations of RNA-binding proteins influenced by IQCH activity. These approaches can be combined with RNA stability assays in cultured germ cells with IQCH knockdown or overexpression to determine how IQCH modulation affects the half-life of specific transcripts critical for spermatogenesis. For mechanistic insights, researchers can employ luciferase reporter assays incorporating 3'UTR elements from IQCH-regulated transcripts to assess how IQCH levels influence post-transcriptional regulation .

Proteomics approaches comparing the interactomes of RNA-binding proteins in the presence or absence of IQCH can reveal how IQCH influences the assembly of ribonucleoprotein complexes critical for RNA processing during spermatogenesis. Additionally, single-molecule RNA fluorescence in situ hybridization (smFISH) combined with immunofluorescence for RNA-binding proteins allows visualization of both RNA localization and protein distribution in individual germ cells, potentially revealing altered RNA-protein interactions in IQCH-deficient cells. These combined approaches provide comprehensive insights into how IQCH, through its interaction with calmodulin, regulates RNA-binding proteins that orchestrate the complex transcriptional program of spermatogenesis .

How can IQCH antibodies contribute to genetic diagnosis and counseling for male infertility?

IQCH antibodies represent valuable tools for translating genetic findings into clinically relevant diagnostic approaches for male infertility cases. Immunohistochemical analysis of testicular biopsies using anti-IQCH antibodies can help clinicians visualize IQCH protein expression and localization patterns in patients with idiopathic infertility, potentially identifying individuals with protein expression defects despite normal gene sequences. This approach complements genetic testing by revealing post-transcriptional or post-translational abnormalities that might not be detectable through DNA sequencing alone .

For cases with identified IQCH mutations, particularly splice site variants like the c.387+1_387+10 deletion described in recent research, antibody-based approaches can verify the impact of these mutations on protein expression in patient samples. Western blot analysis of seminal plasma or testicular biopsy samples using validated anti-IQCH antibodies can confirm whether mutations result in protein absence, truncation, or altered levels, providing functional validation of genetic findings. This information strengthens the clinical interpretation of variants of uncertain significance and improves genetic counseling accuracy .

Furthermore, immunofluorescence analysis of sperm samples using anti-IQCH antibodies can reveal specific structural abnormalities associated with IQCH deficiency, such as the cracked flagellar axoneme and abnormal mitochondrial structure described in affected individuals. This phenotypic characterization helps classify patients into specific molecular subtypes of male infertility, potentially guiding therapeutic approaches or reproductive technology choices. The development of standardized immunodiagnostic protocols incorporating anti-IQCH antibodies could facilitate broader clinical implementation, improving the molecular diagnosis of male infertility cases previously classified as idiopathic .

What methodological approaches can researchers use to study IQCH mutations and their functional consequences?

Researchers investigating IQCH mutations can employ a comprehensive toolkit of methodological approaches to characterize their functional impact on male fertility. Minigene splicing assays represent an essential technique for analyzing splice site mutations, such as the c.387+1_387+10 deletion identified in a Chinese family with male infertility. This approach involves cloning wild-type and mutant IQCH sequences into expression vectors, transfecting them into cultured cells, and analyzing the resulting transcripts by RT-PCR and sequencing to determine how mutations affect mRNA processing .

CRISPR-Cas9 genome editing provides a powerful method for modeling patient mutations in cellular or animal systems. By introducing specific IQCH mutations into model organisms, researchers can recapitulate the phenotypes observed in patients and investigate underlying mechanisms. The successful generation of IQCH knockout mice using CRISPR-Cas9 targeting exons 2-3 demonstrates the feasibility of this approach, which could be extended to create precise knock-in models of specific patient mutations .

For assessing the impact of mutations on protein-protein interactions, researchers can employ yeast two-hybrid screens or co-immunoprecipitation studies comparing wild-type and mutant IQCH. These approaches can determine whether specific mutations disrupt the ability of IQCH to bind calmodulin or other interaction partners essential for its function in spermatogenesis. Additionally, immunofluorescence studies of transfected cells expressing tagged wild-type or mutant IQCH can reveal alterations in subcellular localization that might contribute to pathogenesis. By combining these methodological approaches, researchers can build comprehensive models of how specific IQCH mutations disrupt protein function and ultimately lead to male infertility .

How can researchers use IQCH antibodies for comparative studies across species?

For immunohistochemistry applications across species, researchers should optimize antigen retrieval protocols for each species individually, as fixation artifacts and tissue composition differences can significantly impact epitope accessibility. When planning evolutionary studies, researchers might consider developing antibodies against synthetic peptides representing highly conserved IQCH regions to maximize cross-species utility. Additionally, combining antibody-based approaches with orthogonal techniques such as RNA in situ hybridization provides complementary data that strengthens comparative analyses of IQCH expression and function across diverse species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.