KAAG1 Human

Kidney Associated Antigen 1 Human Recombinant
Shipped with Ice Packs
In Stock

Description

Introduction to KAAG1 Human

KAAG1 (Kidney-Associated Antigen 1), also known as RU2AS, is an 84-amino acid protein encoded by the reverse strand of the DCDC2 gene. Initially identified in renal carcinoma cell lines, it is expressed in normal tissues such as testis, kidney, urinary bladder, and liver, but exhibits restricted normal tissue expression compared to its high prevalence in cancers . Its unique expression profile makes it a promising target for therapeutic interventions, particularly antibody-drug conjugates (ADCs) .

Amino Acid Sequence

KAAG1 is a non-glycosylated polypeptide with a molecular mass of ~11.1 kDa. The recombinant form includes a His-tag for purification and comprises the sequence:

Amino Acid Sequence (1-84)
MGSSHHHHHHSSGLVPRGSHMDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Source: Abcam , Prospec Bio

Production and Purity

KAAG1 is produced in E. coli, purified via chromatography, and formulated in Tris-HCl buffer with DTT and NaCl. Recombinant variants achieve >90% purity, validated via SDS-PAGE and mass spectrometry .

Expression and Tissue Specificity

KAAG1 is overexpressed in multiple malignancies, including:

Cancer TypeExpression LevelKey References
Ovarian CancerHigh
Triple-Negative BreastHigh
Prostate (Castration-Resistant)High
Renal Cell CarcinomaHigh
Colorectal CarcinomaModerate

Normal tissue expression is limited, with trace levels in liver and urinary bladder .

Antibody-Drug Conjugates (ADCs)

3A4-PL1601 (preclinical) and ADCT-901 (clinical) are PBD dimer-based ADCs targeting KAAG1:

ADC Feature3A4-PL1601ADCT-901
PayloadSG3199 (PBD dimer)SG3199
LinkerValine-AlanineCathepsin-cleavable
DAR~2Not disclosed
In Vivo EfficacyCR in TNBC/xenograftOngoing Phase 1
PK Half-Life~8 days (rat)~6 days (monkey)
MTD1 mg/kg (rat)290 µg/kg (human)
Source:

Mechanism: KAAG1’s rapid internalization and lysosomal localization enable efficient payload delivery .

Phase 1 Trial (ADCT-901)

  • Design: Escalating doses (15–290 µg/kg Q3W) in advanced solid tumors (ovarian, renal, TNBC, cholangiocarcinoma) .

  • Endpoints: Dose-limiting toxicities (DLTs), safety, pharmacokinetics, and response rate .

Antibody Engineering and Epitope Mapping

Humanized antibodies (e.g., 3C4, 3D3, 3G10) target distinct KAAG1 epitopes:

AntibodyEpitope (Amino Acids)Function
3C41–35ADCC/CMC-mediated killing
3D336–60Internalization-dependent
3G1061–84Lysosomal targeting
Source:

Challenges and Future Directions

  • Toxicity: Preclinical MTDs in non-human primates were lower than in rats, necessitating careful dose escalation .

  • Biomarker Validation: Tumor biopsy-based KAAG1 expression assessment is critical for patient stratification .

  • Combination Therapies: Synergy with checkpoint inhibitors or chemotherapy may enhance ADC efficacy.

Product Specs

Introduction
Kidney associated antigen 1 (KAAG1) is found in the testis and kidney, and in smaller amounts, in the urinary bladder and liver. KAAG1 is present in many tumors of different types, including melanomas, sarcomas, and colorectal carcinomas.
Description
KAAG1 Human Recombinant, combined with a 20 amino acid His tag at the N-terminus and produced in E.Coli, is a single, non-glycosylated polypeptide chain containing 104 amino acids (1-84 a.a.) with a molecular weight of 11.1kDa. KAAG1 is purified using specialized chromatographic techniques.
Physical Appearance
Clear, sterile solution without color.
Formulation
The KAAG1 solution (0.5 mg/ml) contains 20mM Tris-HCl buffer (pH 8.0), 1mM DTT, 10% glycerol, and 100mM NaCl.
Stability
For short-term storage (2-4 weeks), keep at 4°C. For longer periods, store frozen at -20°C. Adding a carrier protein (0.1% HSA or BSA) is recommended for extended storage. Avoid repeatedly freezing and thawing.
Purity
Purity exceeds 90.0% as assessed by SDS-PAGE.
Synonyms

Kidney-associated antigen 1, RU2 antisense gene protein, KAAG1, RU2AS, MGC78738.

Source
Escherichia Coli.
Amino Acid Sequence

MGSSHHHHHH SSGLVPRGSH MDDDAAPRVE GVPVAVHKHA LHDGLRQVAG PGAAAAHLPR WPPPQLAASR REAPPLSQRP HRTQGAGSPP ETNEKLTNPQ VKEK.

Q&A

What is KAAG1 and where is it encoded in the human genome?

KAAG1 (Kidney-associated antigen 1) is an 84 amino acid protein encoded by the reverse strand of a housekeeping gene called DCDC2. The gene is located on chromosome 6, specifically at cytoband 6p22.1, with the mRNA accession number NM_181337 . When designing experiments to study KAAG1, researchers should consider this antisense arrangement, as it complicates primer design and genetic manipulation strategies. Always verify primer specificity to avoid interfering with DCDC2 expression, and consider using strand-specific approaches when analyzing expression data.

What is the molecular structure and functional domains of KAAG1?

While detailed structural information is limited in current literature, researchers investigating KAAG1 should employ multiple complementary structural biology techniques. X-ray crystallography or cryo-electron microscopy can elucidate the three-dimensional structure, while protein interaction studies can identify functional domains. For antibody development, epitope mapping is essential to target accessible regions of the protein. When designing experiments, consider that KAAG1's relatively small size (84 amino acids) may influence its biochemical properties and interaction potential .

How can KAAG1 expression be reliably quantified in experimental systems?

For robust quantification of KAAG1 expression, researchers should implement a multi-modal approach. RT-qPCR using primers specific to the KAAG1 transcript (being careful to avoid DCDC2 cross-reactivity) provides mRNA-level quantification. At the protein level, validated antibodies can be used for western blotting, flow cytometry, or immunohistochemistry depending on the experimental context. When conducting studies across different cancer types, standardize detection methods and include appropriate positive and negative controls to ensure reliable cross-comparison of expression levels.

In which cancer types is KAAG1 predominantly expressed and how consistent is this expression?

KAAG1 shows elevated expression in a high percentage of ovarian tumors, triple-negative breast cancers (TNBCs), and castration-resistant prostate cancer, while maintaining restricted expression in normal tissues . When investigating KAAG1 expression in these or other cancers, researchers should employ tissue microarrays covering multiple tumor samples to account for heterogeneity. Correlate expression with clinicopathological features to identify potential associations with disease progression or treatment response. Single-cell RNA sequencing can further reveal whether expression is uniform or restricted to specific cellular subpopulations within tumors.

What methodologies are most appropriate for studying the function of KAAG1 in cancer progression?

To elucidate KAAG1's role in cancer, implement complementary loss-of-function and gain-of-function approaches. CRISPR-Cas9 knockout or siRNA knockdown reveals phenotypes associated with KAAG1 loss, while controlled overexpression systems demonstrate effects of elevated expression. Assess changes in hallmark cancer phenotypes including proliferation, migration, invasion, and resistance to apoptosis. For in vivo studies, consider inducible systems to modulate KAAG1 expression at different stages of tumor development. Transcriptomic and proteomic profiling after KAAG1 manipulation can identify affected pathways and potential mechanism of action.

How does KAAG1 expression correlate with clinical outcomes in cancer patients?

When investigating correlations between KAAG1 expression and clinical outcomes, researchers should employ multivariate analyses to control for confounding factors. Based on available correlation data (CADI-12 correlation of 0.240, p=0.0154) , KAAG1 shows modest but significant correlations in kidney-related contexts. For cancer studies, perform Kaplan-Meier survival analyses stratified by KAAG1 expression levels, and use Cox proportional hazards models to determine if KAAG1 serves as an independent prognostic factor. Tissue microarrays with complete clinical follow-up data provide an efficient platform for these analyses across multiple cancer types.

What makes KAAG1 an attractive target for antibody-drug conjugate (ADC) development?

KAAG1 possesses several characteristics that make it particularly suitable for ADC development: (1) expression in a high percentage of specific cancer types including ovarian tumors, triple-negative breast cancers, and castration-resistant prostate cancer; (2) restricted normal tissue expression, potentially limiting off-target toxicity; and (3) accessibility for antibody binding . When evaluating KAAG1 as an ADC target, researchers should quantitatively assess the differential expression between malignant and normal tissues, confirm cell surface localization, and evaluate internalization kinetics following antibody binding. These parameters are critical for predicting ADC efficacy and therapeutic window.

What approaches have been developed for targeting KAAG1 in cancer and how effective are they?

One prominent approach is the development of 3A4-PL1601, an ADC composed of a humanized IgG1 antibody against human KAAG1, site-specifically conjugated using GlycoconnectTM technology to PL1601. This ADC incorporates HydraspaceTM, a valine-alanine cleavable linker, and the PBD dimer cytotoxin SG3199, with a drug-to-antibody ratio (DAR) of approximately 2 . When evaluating the efficacy of such approaches, researchers should assess specificity for KAAG1-expressing cells, cytotoxic potency in vitro, and anti-tumor activity in vivo using appropriate xenograft models. Additionally, investigate potential mechanisms of resistance that might emerge during treatment.

How can in vitro and in vivo models be optimized to evaluate KAAG1-targeted therapies?

For robust evaluation of KAAG1-targeted therapies, researchers should develop model systems with varying levels of KAAG1 expression to establish dose-response relationships. In vitro, use isogenic cell line pairs differing only in KAAG1 status to directly attribute observed effects to target engagement. For in vivo studies, consider both subcutaneous and orthotopic xenograft models to account for microenvironment influences. Patient-derived xenografts may better recapitulate tumor heterogeneity and clinical response patterns. Implement pharmacokinetic and pharmacodynamic analyses to correlate drug exposure with target engagement and subsequent anti-tumor effects.

What potential resistance mechanisms should be investigated for KAAG1-targeted therapies?

When studying resistance to KAAG1-targeted therapies, investigate multiple potential mechanisms: (1) loss or downregulation of KAAG1 expression; (2) mutations affecting antibody binding epitopes; (3) altered internalization or intracellular trafficking of the ADC; (4) upregulation of drug efflux pumps; and (5) activation of compensatory survival pathways. Generate resistant cell lines through chronic exposure to KAAG1-targeted agents and perform genomic, transcriptomic, and proteomic profiling to identify resistance drivers. This knowledge can guide the development of combination strategies or next-generation targeting approaches to overcome resistance.

What is the optimal approach for generating and validating anti-KAAG1 antibodies?

For antibody development against KAAG1, researchers should carefully consider epitope selection to ensure specificity and functional relevance. Based on the existence of humanized IgG1 antibodies against KAAG1 (like 3A4) , immunogenic epitopes clearly exist. Implement a comprehensive validation pipeline including: (1) ELISA to confirm binding to recombinant KAAG1; (2) western blotting to verify size-specific detection; (3) immunoprecipitation to demonstrate native protein recognition; (4) immunohistochemistry to confirm expected tissue expression patterns; and (5) functional assays relevant to the intended application. Always include KAAG1 knockout controls to definitively demonstrate specificity.

How can KAAG1 surface expression be quantitatively assessed across cell lines and patient samples?

To quantitatively assess KAAG1 surface expression, flow cytometry provides the most reliable approach. Researchers should develop a standardized protocol using validated anti-KAAG1 antibodies and appropriate isotype controls. For absolute quantification, include calibration beads with known antibody binding capacity. In patient samples, consider mass cytometry (CyTOF) for simultaneous assessment of KAAG1 and other relevant markers. For tissue sections, quantitative immunohistochemistry with digital image analysis allows spatial assessment of expression. Always validate findings using multiple antibody clones targeting different epitopes to ensure specificity.

What experimental design considerations are critical when investigating KAAG1 in xenograft models?

When designing xenograft studies for KAAG1 research, several methodological considerations are essential. First, verify KAAG1 expression is maintained in vivo through initial pilot studies with immunohistochemical analysis of harvested tumors. Include cell lines with varying KAAG1 expression levels to establish dose-response relationships. For therapeutic studies, begin treatment at clinically relevant tumor volumes (100-200 mm³) and include appropriate vehicle and isotype control groups. Power analyses should determine animal numbers needed for statistical significance, and predetermined endpoints should be clearly defined. Consider complementary pharmacodynamic studies to confirm mechanism of action.

How might the antisense relationship between KAAG1 and DCDC2 complicate experimental approaches and data interpretation?

The antisense relationship between KAAG1 and DCDC2 presents unique experimental challenges. When designing genetic manipulation strategies (CRISPR knockout, overexpression, etc.), carefully assess potential impacts on DCDC2 expression. Employ strand-specific RNA sequencing to accurately differentiate between KAAG1 and DCDC2 transcripts. For siRNA approaches, extensively validate knockdown specificity by measuring both targets. When interpreting phenotypic changes after KAAG1 manipulation, consider the possibility of DCDC2-mediated effects. This genomic arrangement may also have regulatory implications, with potential coordinated expression or reciprocal regulation that should be systematically investigated.

What are the most promising combination therapy approaches involving KAAG1-targeted agents?

When investigating combination therapies with KAAG1-targeted agents, consider mechanistic rationales based on KAAG1 biology and the specific cancer context. For ADCs like 3A4-PL1601 , combinations with immune checkpoint inhibitors may enhance efficacy through immunogenic cell death triggered by the cytotoxic payload. DNA-damaging agents may synergize with PBD-based ADCs by overwhelming DNA repair mechanisms. Design combination studies using appropriate in vitro models to identify synergistic pairs, followed by in vivo validation. Use formal synergy analysis methods (Chou-Talalay, Bliss independence) to quantitatively assess combinatorial effects rather than relying on subjective assessments.

How can translational biomarkers for KAAG1-targeted therapies be developed and validated?

Development of translational biomarkers for KAAG1-targeted therapies requires a systematic approach. Beyond simply measuring KAAG1 expression, investigate whether specific thresholds correlate with response. Consider developing assays for measuring target engagement (e.g., reduction in available KAAG1 after antibody administration) and downstream pharmacodynamic effects specific to the mechanism of action. For DNA-damaging payloads like SG3199 , markers of DNA damage response (γH2AX, 53BP1 foci) may serve as early response indicators. Validate proposed biomarkers retrospectively in preclinical models, then prospectively in early-phase clinical trials, ensuring analytical validity, clinical validity, and clinical utility.

Table 1: KAAG1 Characteristics and Expression Profile

AttributeDetailsReference
Protein Size84 amino acids
Genomic LocationChromosome 6p22.1
mRNA AccessionNM_181337
Gene ContextEncoded on reverse strand of DCDC2
Expression in Ovarian TumorsHigh percentage
Expression in Triple-Negative Breast CancerHigh percentage
Expression in Castration-Resistant Prostate CancerHigh percentage
Normal Tissue ExpressionRestricted
CADI-12 Correlation0.240 (p=0.0154)

Table 2: Anti-KAAG1 Therapeutic Development

Therapeutic ApproachComponent DetailsTechnical SpecificationsReference
3A4-PL1601 ADCAntibody ComponentHumanized IgG1 against human KAAG1
Conjugation MethodGlycoconnectTM technology
Spacer TechnologyHydraspaceTM
Linker TypeValine-alanine cleavable linker
Cytotoxic PayloadPBD dimer SG3199
Drug-to-Antibody Ratio~2
Patent-Protected ApproachesAnti-KAAG1 antibodiesMultiple antibody and antigen-binding fragment approaches

Product Science Overview

Expression and Localization

KAAG1 is primarily expressed in the testis and kidney . It is also found, albeit at lower levels, in the urinary bladder and liver . This protein is notable for its high expression in a variety of tumors, including melanomas, sarcomas, and colorectal carcinomas . The selective expression of KAAG1 in these tissues and tumors makes it a valuable target for research and potential therapeutic interventions.

Recombinant Production

The recombinant form of KAAG1 is produced using Escherichia coli (E. coli) as the expression system . This involves the insertion of the KAAG1 gene into the bacterial cells, which then produce the protein. The recombinant protein is typically fused with a His-tag at the N-terminus to facilitate purification . The resulting protein is purified using conventional chromatography techniques to achieve a purity level of over 90%, as determined by SDS-PAGE .

Structural and Functional Characteristics

The recombinant KAAG1 protein consists of 84 amino acids and has a theoretical molecular weight of approximately 11.1 kDa . However, the observed molecular weight may vary due to post-translational modifications and other experimental factors . The protein is stored in a buffer containing 20 mM Tris-HCl (pH 8.0), 10% glycerol, and 0.1 M NaCl to maintain its stability .

Clinical and Research Implications

KAAG1’s expression in a high proportion of tumors of various histologic origins makes it a promising candidate for cancer research. It is particularly relevant in the study of melanomas, sarcomas, and colorectal carcinomas . The protein’s selective expression in tumors and its ability to be internalized and co-localized with lysosomal markers make it an ideal target for antibody-drug conjugates (ADCs) . ADCs are a class of targeted cancer therapies that deliver cytotoxic agents directly to cancer cells, minimizing damage to healthy tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.