TPK1 Antibody

What is TPK1 and what is its primary function in cellular metabolism?

TPK1 (thiamin pyrophosphokinase 1), also known as placental protein 20 (PP20), is an enzyme responsible for the conversion of thiamine (vitamin B1) to thiamine pyrophosphate (TPP) . As a member of the thiamine pyrophosphokinase family, TPK1 plays a crucial role in thiamine metabolism by catalyzing the phosphorylation of thiamine to thiamine pyrophosphate . TPK1 primarily utilizes UTP for this phosphorylation reaction, linking TPP biosynthesis to pyrimidine metabolism . While it can technically use ATP and CTP in vitro, it does so with significantly lower efficiency . By producing thiamine pyrophosphate, which serves as a cofactor for the mitochondrial pyruvate dehydrogenase complex, TPK1 indirectly regulates pyruvate oxidation and lipogenesis, making it an important metabolic control point .

What are the recommended applications for TPK1 antibodies in laboratory research?

TPK1 antibodies have been validated for multiple applications across various research methodologies:

It is strongly recommended to optimize antibody concentration for each specific experimental system to obtain optimal results, as performance may vary based on sample type and preparation method .

What is the molecular weight of TPK1 and how does this inform antibody validation?

TPK1 has a calculated molecular weight of 28 kDa, which corresponds to its observed molecular weight in experimental settings . This consistency between calculated and observed molecular weights is an important parameter for validating antibody specificity in Western blot applications. When conducting Western blot analysis, researchers should expect to observe a single band at approximately 28 kDa in human, mouse, and rat samples. Any additional bands may indicate non-specific binding or degradation products. Establishing the correct molecular weight is an essential step in antibody validation protocols and should be performed when using TPK1 antibodies in a new experimental system or with different sample types .

What species reactivity has been confirmed for commercially available TPK1 antibodies?

The available TPK1 antibodies demonstrate consistent reactivity across several mammalian models:

This cross-species reactivity is particularly valuable for researchers conducting comparative studies across different model organisms or translating findings from animal models to human applications . The conservation of TPK1 across mammalian species facilitates such translational research, though researchers should always verify antibody performance in their specific experimental system.

What tissue and cell types show positive TPK1 expression?

TPK1 expression has been detected in various tissues and cell types, with particularly strong expression noted in:

Cell lines with confirmed positive Western blot results:

• SH-SY5Y cells (human neuroblastoma)

• HEK-293 cells (human embryonic kidney)

• L02 cells (human hepatic)

Tissues with confirmed positive expression:

• Human small intestine tissue

• Human kidney tissue

• Human duodenum (strong cytoplasmic positivity in glandular cells)

• Human colon cancer tissue

• Mouse testis tissue

• Mouse/rat small intestine tissue

• Mouse kidney tissue

This expression pattern suggests TPK1 plays important roles in metabolic processes across multiple organ systems. Researchers investigating tissue-specific functions of TPK1 should consider these expression profiles when designing experiments .

How does phosphorylation affect TPK1 function and what kinases are responsible for this modification?

In Arabidopsis, TPK1 (a vacuolar potassium channel) undergoes phosphorylation that significantly impacts its function in salt-stress adaptation. Several calcium-dependent protein kinases (CDPKs) have been identified to phosphorylate TPK1, including CPK3, CPK4, CPK5, and CPK11 . These kinases efficiently phosphorylate the N-terminal peptide of TPK1 in a calcium-dependent manner.

The phosphorylation specifically targets Ser-42 within the 14-3-3 binding motif in the cytosolic TPK1 N-terminus . This modification is particularly significant as it enhances the binding of 14-3-3 proteins (specifically GRF6, a 14-3-3 protein also known as GF14-lambda) to TPK1. The interaction between phosphorylated TPK1 and 14-3-3 proteins increases the open probability of this calcium-activated potassium channel .

For researchers investigating TPK1 phosphorylation, in vitro kinase assays using purified recombinant GST-TPK1 N-terminus and specific CDPKs can be employed, with phosphorylation detection using phospho-specific antibodies that recognize phosphorylated 14-3-3 binding motifs .

What are the recommended protocols for optimizing TPK1 antibody use in immunohistochemistry?

Optimizing TPK1 antibody use in immunohistochemistry requires careful attention to several technical parameters:

Antigen retrieval techniques:

• Primary recommendation: TE buffer pH 9.0

• Alternative method: Citrate buffer pH 6.0

Dilution optimization:

• Starting dilution range: 1:200-1:800 or 1:20-1:50 (antibody-dependent)

• Systematic titration recommended for each tissue type

Sample preparation considerations:

• Fixation: 10% neutral buffered formalin is typically suitable

• Section thickness: 4-6 μm sections generally provide optimal results

• Blocking: Use appropriate blocking solutions to minimize background staining

Validation controls:

• Positive tissue controls: Human kidney tissue, human duodenum, and human colon cancer tissue have shown consistent TPK1 expression

• Negative controls: Omit primary antibody while maintaining all other steps

• Competing peptide controls: Pre-incubation with immunizing peptide should abolish specific staining

For difficult tissues or applications requiring enhanced sensitivity, signal amplification systems like tyramide signal amplification may be beneficial. Always validate new tissue types by comparing staining patterns with established positive controls and literature-reported expression patterns .

How can researchers validate TPK1 antibody specificity using knockout/knockdown approaches?

Validating TPK1 antibody specificity through knockout/knockdown approaches is a critical step in ensuring experimental rigor. Based on the search results, TPK1 antibodies have been validated in knockout/knockdown contexts as evidenced by published literature . Researchers can implement the following validation protocol:

• Generate TPK1 knockdown models:

  • siRNA or shRNA targeting TPK1 in appropriate cell lines

  • CRISPR-Cas9 mediated knockout in cell lines

  • Conditional knockout mouse models for in vivo validation

• Experimental validation workflow:

  • Confirm knockdown/knockout efficiency at mRNA level using qRT-PCR

  • Compare Western blot results between wildtype and KD/KO samples using the TPK1 antibody

  • Expect complete absence (KO) or significant reduction (KD) of the 28 kDa band

  • Perform parallel immunohistochemistry or immunofluorescence on control and KD/KO samples

• Troubleshooting persistent signals:

  • If signal persists in knockout samples, evaluate potential cross-reactivity with related proteins

  • Check for incomplete knockout or compensatory mechanisms

  • Consider additional validation methods such as mass spectrometry

This approach provides the highest level of confidence in antibody specificity and should be documented thoroughly in publications to enhance reproducibility .

What are the considerations for using TPK1 antibodies in co-immunoprecipitation studies?

Co-immunoprecipitation (Co-IP) using TPK1 antibodies requires careful optimization to preserve protein-protein interactions while achieving specific pulldown. Based on the search results showing successful immunoprecipitation of TPK1 from mouse kidney tissue , researchers should consider:

Protocol optimization parameters:

• Antibody amount: 0.5-4.0 μg antibody per 1.0-3.0 mg of total protein lysate

• Lysis buffer composition: Use mild non-ionic detergents (0.5-1% NP-40 or Triton X-100) to preserve protein interactions

• Salt concentration: Typically 100-150 mM NaCl provides a balance between specificity and maintaining interactions

• Buffer pH: Maintain physiological pH (7.2-7.5) to preserve native protein conformations

Technical considerations:

• Pre-clearing lysates with appropriate control IgG and protein A/G beads reduces non-specific binding

• Include appropriate negative controls (non-specific IgG, irrelevant antibody)

• Confirm successful IP by Western blotting a portion of the immunoprecipitate for TPK1

• Consider crosslinking antibodies to beads to prevent antibody bands in subsequent Western blot analysis

Potential interacting partners:

• Based on plant TPK1 studies, 14-3-3 proteins may be interaction partners worth investigating

• Thiamine metabolism pathway components could be logical interaction candidates for mammalian TPK1

Researchers should validate all co-IP results with reciprocal experiments and additional protein interaction methods when possible .

How does the subcellular localization of TPK1 influence experimental design and interpretation?

The subcellular localization of TPK1 has significant implications for experimental design and data interpretation. While the search results don't explicitly detail TPK1's subcellular distribution in mammalian cells, information about plant TPK1 indicates it localizes to vacuolar membranes , and immunofluorescence studies of human TPK1 show cytoplasmic patterns .

Experimental design considerations:

• Subcellular fractionation: When preparing samples for biochemical analyses, researchers should consider including subcellular fractionation steps to enrich for TPK1-containing compartments

• Immunofluorescence optimization: For co-localization studies, optimize fixation methods that preserve both TPK1 and potential marker proteins (paraformaldehyde typically at 2-4% is recommended)

• Confocal microscopy settings: Use appropriate filters and settings to distinguish true TPK1 signal from background or autofluorescence

Data interpretation guidelines:

• Cytoplasmic staining patterns should be carefully evaluated to distinguish between diffuse cytosolic distribution versus association with specific organelles

• Co-localization studies should include quantitative analysis (e.g., Pearson's correlation coefficient)

• Changes in localization under experimental conditions may indicate functional regulation of TPK1

Relevant markers for co-localization studies:

• Cytosolic markers: GAPDH, tubulin

• ER markers: Calnexin, KDEL-tagged proteins

• Mitochondrial markers: TOMM20, MitoTracker dyes

Understanding TPK1's precise subcellular distribution is essential for correctly interpreting experimental results and for designing studies that accurately capture its physiological function in different cellular compartments .

What are the optimal sample preparation protocols for detecting TPK1 in different sample types?

Optimal sample preparation for TPK1 detection varies by sample type and detection method. Based on the search results, the following protocols are recommended:

For Western blot analysis:

• Cell lines: Lyse cells in RIPA buffer (150 mM NaCl, 1.0% NP-40, 0.5% sodium deoxycholate, 0.1% SDS, 50 mM Tris-HCl pH 8.0) supplemented with protease inhibitors

• Tissue samples: Homogenize fresh or snap-frozen tissues in RIPA buffer (10:1 v/w ratio), followed by centrifugation at 14,000g for 15 minutes at 4°C

• Protein quantification: Use BCA or Bradford assay to normalize loading

• Sample denaturation: Heat samples at 95°C for 5 minutes in Laemmli buffer containing 5% β-mercaptoethanol

For immunohistochemistry:

• Fixation: 10% neutral buffered formalin for 24-48 hours

• Processing: Standard paraffin embedding procedures

• Sectioning: 4-6 μm sections

• Antigen retrieval: TE buffer pH 9.0 (preferred) or citrate buffer pH 6.0 (alternative)

• Blocking: 5-10% normal serum from the same species as the secondary antibody

For immunoprecipitation:

• Tissue lysis: Use milder lysis buffers (e.g., 1% NP-40, 150 mM NaCl, 50 mM Tris-HCl pH 7.5) supplemented with protease and phosphatase inhibitors

• Pre-clearing: Incubate lysates with protein A/G beads for 1 hour at 4°C

• Antibody binding: Use 0.5-4.0 μg antibody per 1.0-3.0 mg of total protein lysate

Regardless of the application, fresh sample preparation and inclusion of appropriate controls are essential for reliable TPK1 detection .

How can researchers troubleshoot non-specific binding when using TPK1 antibodies?

Non-specific binding can compromise experimental results when using TPK1 antibodies. Based on the search results and general antibody best practices, researchers can implement the following troubleshooting strategies:

For Western blot applications:

• Blocking optimization:

  • Increase blocking time (1-2 hours at room temperature)

  • Test different blocking agents (5% non-fat dry milk, 5% BSA, commercial blocking solutions)

  • Consider additives like 0.1% Tween-20 in blocking and antibody dilution buffers

• Antibody dilution adjustment:

  • Increase dilution within recommended range (1:1000-1:8000)

  • Reduce primary antibody incubation time or temperature

• Washing optimization:

  • Increase number of washes (5-6 washes of 5-10 minutes each)

  • Use higher concentration of detergent in wash buffer (0.1-0.3% Tween-20)

For immunohistochemistry applications:

• Antigen retrieval modifications:

  • Optimize antigen retrieval method between TE buffer pH 9.0 and citrate buffer pH 6.0

  • Adjust retrieval time and temperature

• Background reduction strategies:

  • Add 0.3% hydrogen peroxide in methanol block (10 minutes) to quench endogenous peroxidases

  • Include avidin/biotin blocking step if using biotin-based detection systems

  • Consider adding 0.3% Triton X-100 during blocking to reduce hydrophobic interactions

• Controls to identify source of non-specificity:

  • No primary antibody control (to check secondary antibody specificity)

  • Isotype control (to check for Fc receptor binding)

  • Peptide competition (pre-incubation of antibody with immunizing peptide should eliminate specific binding)

If non-specific binding persists, researchers should consider testing alternative TPK1 antibodies or purifying the antibody through affinity methods to enhance specificity .

What strategies can be employed to enhance signal detection for low-abundance TPK1 expression?

When working with samples exhibiting low TPK1 expression, several signal enhancement strategies can be implemented:

For Western blot applications:

• Sample enrichment approaches:

  • Increase protein loading (up to 50-100 μg per lane)

  • Perform subcellular fractionation to concentrate TPK1-containing compartments

  • Use immunoprecipitation as a pre-enrichment step before Western blotting

• Detection system optimization:

  • Utilize high-sensitivity ECL substrates

  • Consider fluorescent secondary antibodies with digital imaging systems

  • Employ biotin-streptavidin amplification systems

• Exposure optimization:

  • Increase exposure time incrementally

  • Use cooled CCD camera systems for long exposures without background increases

For immunohistochemistry applications:

• Signal amplification methods:

  • Employ tyramide signal amplification (TSA) systems

  • Use polymer detection systems with multiple HRP molecules

  • Consider sequential application of primary and secondary antibodies

• Protocol modifications:

  • Increase primary antibody concentration or incubation time (overnight at 4°C)

  • Reduce washing stringency slightly (shorter wash times or reduced detergent)

  • Use higher sensitivity chromogens (e.g., DAB-nickel instead of standard DAB)

• Technical considerations:

  • Use freshly prepared tissues/samples when possible

  • Minimize time between sectioning and staining for optimal antigen preservation

  • Consider alternative fixatives that may better preserve TPK1 epitopes

These approaches should be systematically evaluated while maintaining appropriate controls to ensure that enhanced signals remain specific to TPK1 .

How do different storage conditions affect TPK1 antibody performance over time?

Proper storage of TPK1 antibodies is crucial for maintaining their performance characteristics over time. Based on the manufacturer information in the search results, the following guidelines should be followed:

Storage temperature recommendations:

• Store TPK1 antibodies at -20°C for long-term stability

• Avoid repeated freeze-thaw cycles by preparing small aliquots

Buffer composition considerations:

• TPK1 antibodies are typically provided in PBS with 0.02% sodium azide and 50% glycerol at pH 7.3

• This formulation helps maintain antibody stability during freeze-thaw cycles

• For antibodies provided without glycerol, consider adding glycerol to 50% final concentration before aliquoting

Stability timeline:

• When stored properly at -20°C, TPK1 antibodies remain stable for one year after shipment

• Aliquoting is not necessary for -20°C storage of glycerol-containing formulations, but is recommended to prevent contamination

Working dilution handling:

• Prepare working dilutions on the day of experiment when possible

• If storage of working dilutions is necessary, keep at 4°C for no more than 1-2 weeks

• Add protein carriers (0.1-0.5% BSA) to working dilutions to prevent adsorption to tubes

Signs of antibody deterioration:

• Increased background

• Decreased specific signal intensity

• Appearance of non-specific bands in Western blots

• Precipitate formation

If decreased performance is observed, researchers should compare results with a fresh aliquot to determine if antibody degradation is the cause .

What are the validated epitopes for different TPK1 antibodies and how might this affect experimental design?

Understanding the specific epitopes recognized by TPK1 antibodies is critical for experimental design, especially when studying protein interactions, post-translational modifications, or using multiple antibodies simultaneously. The search results provide information about several TPK1 antibody epitopes:

Proteintech (10942-1-AP):

• Immunogen: TPK1 fusion protein Ag1404

• This antibody may recognize multiple regions of the protein

Sigma-Aldrich (HPA021545):

• Immunogen sequence: HRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGTLVSTSNTYDGSGVVTVETDHPL

• This represents a specific region of TPK1 protein

Novus Biologicals (NBP1-83152):

• Immunogen: Recombinant Protein corresponding to amino acids: HRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGTLVSTSNTYDGSGVVTVETDHPL

• This appears to be the same epitope as the Sigma antibody

Abcam (ab230263):

• Immunogen: Recombinant Full Length Protein corresponding to Human TPK1

• This antibody likely recognizes multiple epitopes across the full protein

Experimental design considerations based on epitope information:

• For detecting protein interactions:

  • If the epitope is within a protein interaction interface, antibody binding may be blocked when TPK1 is engaged with its binding partners

  • For co-IP studies, consider using antibodies targeting regions outside known interaction domains

• For detecting post-translational modifications:

  • If studying phosphorylation of TPK1 (as in plant TPK1 ), ensure the epitope does not contain or overlap with potential phosphorylation sites

  • For detecting modified forms, epitope accessibility may change upon modification

• For using multiple antibodies:

  • When performing double-labeling experiments, choose antibodies targeting different epitopes

  • For validation, concordant results with antibodies recognizing different epitopes provide stronger evidence

• For detecting specific isoforms or domains:

  • Select antibodies with epitopes unique to the isoform/domain of interest

  • Epitope mapping can help identify the most suitable antibody for specialized applications

Researchers should consider these epitope characteristics when designing experiments, particularly for specialized applications like chromatin immunoprecipitation, proximity ligation assays, or super-resolution microscopy .

What role does TPK1 play in cellular stress responses and how can antibodies help elucidate these pathways?

TPK1 has been implicated in stress response pathways, particularly in plant systems where it functions as a vacuolar potassium channel involved in salt-stress adaptation . Although the search results focus primarily on plant TPK1 for stress responses, the conservation of TPK1 function in thiamine metabolism across species suggests potential roles in mammalian cellular stress responses as well.

In Arabidopsis, TPK1 is activated during salt stress through a calcium-dependent phosphorylation mechanism . The channel's activation allows potassium ions to be released from vacuoles, contributing to cellular osmotic regulation and stress adaptation. TPK1 phosphorylation by calcium-dependent protein kinases (CDPKs) enhances its interaction with 14-3-3 proteins, which increases channel open probability .

Research approaches using TPK1 antibodies to study stress responses:

• Phosphorylation state analysis:

  • Use phospho-specific antibodies to detect stress-induced TPK1 phosphorylation

  • Compare phosphorylation levels across different stress conditions and time points

  • Correlate phosphorylation with functional outcomes

• Protein interaction studies:

  • Employ co-immunoprecipitation with TPK1 antibodies to identify stress-specific binding partners

  • Analyze temporal dynamics of protein complexes during stress induction and recovery

  • Validate interactions through reciprocal co-IPs and orthogonal methods

• Subcellular localization changes:

  • Use immunofluorescence to track potential relocalization of TPK1 during stress responses

  • Combine with organelle-specific markers to quantify distribution changes

  • Correlate localization changes with functional outcomes

• Expression level analysis:

  • Quantify TPK1 protein levels in response to different stressors

  • Compare expression patterns across tissues with differential stress sensitivity

  • Correlate protein levels with enzymatic activity or cellular outcomes

These approaches can help elucidate the specific roles of TPK1 in stress response pathways and potentially identify novel therapeutic targets for stress-related conditions .

How can researchers use TPK1 antibodies to investigate its role in thiamine metabolism disorders?

TPK1 plays a critical role in thiamine metabolism by catalyzing the conversion of thiamine to thiamine pyrophosphate (TPP) . Thiamine pyrophosphate serves as an essential cofactor for several key enzymes involved in carbohydrate metabolism. Disorders in TPK1 function could potentially contribute to thiamine deficiency-like conditions or metabolic dysregulation. Researchers can use TPK1 antibodies to investigate these connections through several approaches:

Clinical research applications:

• Tissue expression profiling:

  • Compare TPK1 expression levels between healthy tissues and samples from patients with thiamine metabolism disorders

  • Correlate expression patterns with disease severity or specific phenotypes

  • Identify tissue-specific alterations that may contribute to localized symptoms

• Biomarker development:

  • Evaluate TPK1 protein levels in accessible biospecimens (blood, urine, CSF)

  • Assess correlation between TPK1 levels/activity and clinical parameters

  • Develop diagnostic or prognostic assays based on TPK1 detection

Mechanistic research approaches:

• Functional interaction studies:

  • Use co-immunoprecipitation with TPK1 antibodies to identify interaction partners in thiamine metabolism pathways

  • Compare interaction profiles between normal and disease models

  • Validate interactions through reciprocal IPs and functional assays

• Subcellular localization in disease states:

  • Analyze potential mislocalization of TPK1 in disease models

  • Correlate subcellular distribution with functional outcomes

  • Identify trafficking mechanisms that may be therapeutically targetable

• Post-translational modification analysis:

  • Investigate regulatory modifications (phosphorylation, acetylation, etc.) of TPK1 in normal vs. disease states

  • Determine how these modifications affect enzymatic activity

  • Identify regulatory kinases or other modifying enzymes as potential therapeutic targets

By employing TPK1 antibodies in these research contexts, investigators can gain deeper insights into the molecular mechanisms underlying thiamine metabolism disorders and potentially identify novel therapeutic approaches .

What are the emerging techniques for multiplexed detection of TPK1 alongside other metabolic enzymes?

Multiplexed detection of TPK1 together with other metabolic enzymes can provide comprehensive insights into metabolic pathway regulation and coordination. Several emerging techniques can be applied for such multiplexed analyses:

Tissue-based multiplexing approaches:

• Multiplex immunofluorescence:

  • Sequential application of primary antibodies from different species

  • Use of spectrally distinct fluorophores for simultaneous detection

  • Application of tyramide signal amplification for enhanced sensitivity

  • Key consideration: Select TPK1 antibodies raised in species different from antibodies against other target enzymes

• Mass cytometry (CyTOF):

  • Antibodies labeled with isotopically pure heavy metals

  • Allows simultaneous detection of 40+ proteins without spectral overlap

  • Provides single-cell resolution for heterogeneity assessment

  • Requires metal-conjugated TPK1 antibodies with validated specificity

• Imaging mass cytometry:

  • Combines mass cytometry with laser ablation of tissue sections

  • Provides spatial context to multiplexed protein detection

  • Allows visualization of TPK1 in relation to other metabolic enzymes within tissue architecture

Solution-based multiplexing technologies:

• Luminex/bead-based assays:

  • TPK1 antibodies conjugated to spectrally distinct beads

  • Simultaneous quantification of multiple metabolic enzymes in a single sample

  • High-throughput capability for large sample sets

  • Requires paired antibodies (capture and detection) for sandwich assay format

• Proximity extension assays:

  • Antibody pairs linked to complementary oligonucleotides

  • Co-localization on target protein enables DNA polymerization and amplification

  • Highly sensitive detection with minimal sample input

  • Can be multiplexed to detect TPK1 alongside numerous other proteins simultaneously

• Single-cell Western blotting:

  • Microfluidic separation of proteins from single cells

  • Sequential probing with different antibodies

  • Provides quantitative data on protein expression at single-cell level

  • Requires highly specific TPK1 antibodies with minimal cross-reactivity

These multiplexed approaches allow researchers to study TPK1 in the context of broader metabolic networks, enabling more comprehensive understanding of metabolic regulation in normal and disease states .

How can researchers quantitatively assess TPK1 expression levels across different experimental conditions?

Quantitative assessment of TPK1 expression across experimental conditions requires robust methodologies that provide reproducible and accurate measurements. Based on the search results, several approaches can be implemented:

Western blot-based quantification:

• Densitometric analysis:

  • Use TPK1 antibodies at optimized dilutions (1:1000-1:8000)

  • Include loading controls (β-actin, GAPDH, α-tubulin) for normalization

  • Employ standard curves with recombinant TPK1 for absolute quantification

  • Analyze using software like ImageJ, Image Lab, or dedicated analysis platforms

• Multiplex fluorescent Western blotting:

  • Use fluorescently-labeled secondary antibodies for TPK1 and loading controls

  • Employ different fluorophores to detect multiple proteins simultaneously

  • Provides wider linear range than chemiluminescence

  • Reduces inter-blot variation by detecting target and control in same lane

Immunoassay-based quantification:

• ELISA development:

  • Sandwich ELISA using capture and detection TPK1 antibodies

  • Include standard curves with recombinant TPK1

  • Optimize antibody pairs to ensure non-overlapping epitope recognition

  • Provides high-throughput quantification across multiple samples

• Automated capillary immunoassay:

  • Systems like Wes or Jess (ProteinSimple) provide automated separation and detection

  • Requires minimal sample input

  • Offers higher reproducibility than traditional Western blots

  • Provides digital data output for direct quantification

Tissue-based quantification:

• Digital pathology approaches:

  • Stain tissue sections using standardized IHC protocols (1:200-1:800 dilution)

  • Image whole slides using digital scanning systems

  • Apply automated analysis algorithms to quantify staining intensity

  • Normalize to tissue area or cell count for cross-sample comparison

• Multiplexed imaging:

  • Perform multiplex immunofluorescence including TPK1 and relevant markers

  • Use automated image analysis for cell-type specific quantification

  • Correlate TPK1 expression with other markers at single-cell level

Statistical considerations for all methods:

• Use appropriate statistical tests based on data distribution

• Include sufficient biological and technical replicates

• Consider power analysis to determine sample sizes needed for detecting expected changes

• Apply multiple comparison corrections when analyzing across numerous conditions

These approaches provide complementary information about TPK1 expression and can be selected based on specific research questions, sample availability, and required sensitivity .

What are the considerations for using TPK1 antibodies in comparative studies across different species?

Using TPK1 antibodies for comparative studies across species requires careful consideration of several factors to ensure valid cross-species comparisons:

Epitope conservation analysis:

• Sequence homology assessment:

  • Compare TPK1 amino acid sequences across target species

  • Focus particularly on the antibody epitope regions

  • For antibodies with known epitopes like Sigma-Aldrich (HPA021545) and Novus Biologicals (NBP1-83152), determine the conservation of the sequence: HRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGTLVSTSNTYDGSGVVTVETDHPL

• Epitope prediction tools:

  • Use bioinformatic tools to predict epitope accessibility in different species

  • Consider potential differences in post-translational modifications that might affect epitope recognition

Experimental validation approaches:

• Species-specific positive controls:

  • Include known positive tissues/cells from each species (e.g., small intestine, kidney)

  • Verify expected molecular weight recognition (28 kDa for mammalian TPK1)

  • Confirm specific cellular/subcellular localization patterns

• Knockout/knockdown validation:

  • Where available, use species-specific knockout/knockdown samples as negative controls

  • This is especially important when working with less commonly used species

Technical optimization considerations:

• Sample preparation harmonization:

  • Standardize fixation protocols across species samples

  • Use identical extraction buffers and procedures for biochemical analyses

  • Process samples simultaneously when possible to minimize technical variation

• Antibody dilution optimization:

  • Determine optimal antibody concentrations independently for each species

  • For Western blot, validate across the recommended range (1:1000-1:8000)

  • For IHC, test dilution series for each species (1:200-1:800)

• Detection system considerations:

  • Select secondary antibodies with appropriate species reactivity

  • Consider species-specific background issues and optimize blocking accordingly

  • Use detection methods with similar sensitivity across all species studied

Data interpretation guidelines:

• Quantitative comparison approaches:

  • Use relative rather than absolute comparisons when possible

  • Normalize to conserved housekeeping proteins appropriate for each species

  • Consider baseline expression differences when interpreting experimental effects

• Functional correlation:

  • Complement antibody-based detection with functional assays

  • Correlate protein levels with enzymatic activity measurements

  • Consider species-specific differences in TPK1 regulation and function

By carefully addressing these considerations, researchers can conduct valid comparative studies of TPK1 across different species, enhancing understanding of both conserved and species-specific aspects of thiamine metabolism .

What are the key considerations for selecting the most appropriate TPK1 antibody for specific research applications?

Selecting the optimal TPK1 antibody requires thoughtful consideration of several factors specific to the intended research application. Based on the search results, researchers should evaluate:

Application compatibility:

• For Western blot applications, antibodies with validated performance at 1:1000-1:8000 dilutions offer flexibility for different expression levels

• For immunohistochemistry, consider antibodies validated with specific antigen retrieval methods (TE buffer pH 9.0 or citrate buffer pH 6.0)

• For co-immunoprecipitation studies, select antibodies validated for IP applications at 0.5-4.0 μg for 1.0-3.0 mg of total protein lysate

Species requirements:

• Ensure the antibody has been validated in your species of interest

• Proteintech (10942-1-AP) offers broad species reactivity (human, mouse, rat)

• For human-only studies, all listed antibodies are suitable

Epitope considerations:

• For studying protein interactions, select antibodies targeting regions outside predicted interaction domains

• For phosphorylation studies, avoid antibodies whose epitopes contain putative phosphorylation sites

• For detecting specific isoforms, choose antibodies with epitopes unique to the target isoform

Validation rigor:

• Prioritize antibodies validated in knockout/knockdown models

• Consider antibodies with multiple validated applications for greater confidence in specificity

• Review available validation data showing expected molecular weight (28 kDa) and tissue expression patterns

Technical format:

• Consider conjugated antibodies for direct detection applications

• Evaluate storage buffer compatibility with your experimental system

• Assess lot-to-lot consistency through manufacturer validation data

By systematically evaluating these factors in the context of specific research needs, investigators can select TPK1 antibodies most likely to yield reliable and interpretable results for their particular applications .

How might advances in antibody technology impact future TPK1 research?

Emerging antibody technologies are poised to significantly enhance TPK1 research in several key areas:

Recombinant antibody development:

• Transition from polyclonal to monoclonal and recombinant antibodies will improve consistency

• Recombinant TPK1 antibodies will offer batch-to-batch reproducibility

• Genetically engineered fragments (Fab, scFv) will provide better tissue penetration and reduced background

• CRISPR-based antibody engineering will enable customization of specificity and affinity

Novel detection modalities:

• Nanobodies and single-domain antibodies will allow access to previously inaccessible epitopes

• Bivalent and bispecific antibodies will enable simultaneous detection of TPK1 and interaction partners

• Click chemistry-compatible antibodies will facilitate on-demand conjugation to various detection molecules

• Proximity-based detection systems will enable visualization of transient TPK1 interactions in situ

Enhanced spatial biology applications:

• Tissue clearing-compatible antibodies will enable whole-organ 3D imaging of TPK1 distribution

• Expansion microscopy-optimized antibodies will provide super-resolution insights into TPK1 localization

• Highly multiplexed imaging using DNA-barcoded antibodies will position TPK1 within complex metabolic networks

• Spatial transcriptomics integration will correlate TPK1 protein with gene expression landscapes

Functional antibody applications:

• Intrabodies designed to track or manipulate TPK1 in living cells

• Optogenetic antibody systems to control TPK1 function with light

• Degrader antibodies (e.g., PROTAC-conjugated) to enable targeted TPK1 degradation

• Cell-penetrating antibodies to modulate TPK1 function in intact cells

Clinical and diagnostic advances:

• Point-of-care diagnostic platforms using TPK1 antibodies for rapid metabolic disease assessment

• Theranostic antibodies that combine detection with therapeutic modulation

• Digital pathology integration for automated TPK1 quantification in clinical samples

• AI-enhanced antibody design for improved epitope targeting and reduced cross-reactivity