KCNK6 Antibody

Introduction to KCNK6 Antibody

KCNK6 antibodies are immunological reagents specifically designed to bind to and detect the KCNK6 protein (Potassium Channel Subfamily K Member 6). These antibodies serve as essential tools for researchers studying potassium channel biology, membrane physiology, and related pathological conditions. Most commercially available KCNK6 antibodies are polyclonal antibodies raised in rabbits, though other varieties exist with different host species and clonality .

The primary applications of KCNK6 antibodies include Western blotting (WB), immunohistochemistry (IHC), immunofluorescence (IF), and enzyme-linked immunosorbent assay (ELISA). These applications allow researchers to detect KCNK6 protein expression, localization, and potential alterations in various experimental and clinical samples .

The KCNK6 Protein: Structure and Function

KCNK6, also known as TWIK-2 (Tandem of Pore Domains in a Weak Inwardly Rectifying K+ Channel 2) or K2P6.1, belongs to the two-pore domain potassium (K2P) channel family . The KCNK6 protein features a distinctive topology characterized by:

• Four transmembrane segments (4TMS)

• Two pore domains (2P)

• Intracellular N- and C-termini

• Functional channel believed to operate as a dimer

KCNK6 channels play critical roles in:

• Maintaining the electrical stability of cells

• Regulating membrane resting potential

• Contributing to background potassium currents

• Counterbalancing cellular depolarization

KCNK6 displays a low single channel conductance of approximately 5pS, is partially activated by arachidonic acid, and can be blocked by volatile anesthetics . Recent research has identified KCNK6 as the potassium channel mediating K+ efflux across the plasma membrane that is essential for NLRP3 inflammasome activation, highlighting its importance in inflammatory processes .

Applications of KCNK6 Antibodies

KCNK6 antibodies have been validated for several experimental techniques:

Western Blotting (WB)

This technique allows researchers to detect and semi-quantify KCNK6 protein expression in tissue or cell lysates. Most KCNK6 antibodies are validated for WB with recommended dilutions ranging from 1:500 to 1:2000 .

Immunohistochemistry (IHC)

IHC enables visualization of KCNK6 protein distribution within tissue sections, providing insights into its cellular and subcellular localization. Some KCNK6 antibodies are specifically validated for both paraffin-embedded (IHC-p) and frozen (IHC-f) sections .

Immunofluorescence (IF/ICC)

This technique allows for high-resolution imaging of KCNK6 localization in cells and tissues, often with co-localization studies using other markers .

Immunoprecipitation (IP)

Certain KCNK6 antibodies, such as Cell Signaling's #92295, are validated for immunoprecipitation studies that can isolate KCNK6 protein complexes for further analysis .

Immunogens and Epitope Mapping

KCNK6 antibodies are typically raised against specific regions of the KCNK6 protein. Examples include:

• Alomone Labs APC-040: Targets peptide (C)ESHQQLSASSHTDYASIPR, corresponding to residues 295-313 of human KCNK6 (Intracellular, C-terminus)

• Antibodies.com A89490: Targets recombinant fusion protein containing amino acids 254-313 of human KCNK6

• Assay Genie CAB16087: Targets sequence QTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDYASIPR

• Abbexa: Targets KLH-conjugated synthetic peptide between 263-292 amino acids from the C-terminal region of human KCNK6

The epitope location can significantly impact antibody performance in different applications and should be considered when selecting an antibody for specific experimental purposes.

KCNK6 in Normal Physiology

KCNK6 antibodies have been instrumental in characterizing the expression pattern of KCNK6 across various tissues and cell types. KCNK6 shows widespread tissue distribution with notable patterns:

• In humans: Expressed in placenta, pancreas, heart, colon, spleen, aorta, and stomach, with low or absent expression in skeletal muscle

• In rats: Widely expressed in brain, heart, kidney, and liver

• In mice: More restricted expression, primarily detected in liver

These expression patterns, revealed through antibody-based techniques, provide valuable insights into the potential physiological roles of KCNK6 in different organ systems and species .

KCNK6 in Pathological Conditions

KCNK6 antibodies have facilitated important discoveries regarding the role of KCNK6 in various pathological conditions:

Breast Cancer

Research employing KCNK6 antibodies has demonstrated that KCNK6 is significantly overexpressed in breast cancer tissues compared to normal breast tissue. Functional studies have established that overexpressed KCNK6 enhances breast cancer cell proliferation, invasion, and migration. These effects may occur by weakening cell adhesion and reducing cell hardness, thus affecting the malignant phenotype of breast cancer cells .

Immunohistochemical analyses with KCNK6 antibodies have verified that KCNK6 expression is significantly upregulated in breast cancer biopsies. Furthermore, knockdown experiments in breast cancer cell lines (MDA-MB-231 and MCF-7) have shown that reducing KCNK6 expression can reverse the malignant phenotype, highlighting KCNK6 as a potential therapeutic target .

Inflammation and Pain

Studies utilizing KCNK6 antibodies have identified potential roles for KCNK6 in inflammatory processes. Research has found that abnormal KCNK6 expression may be associated with inflammation-induced pain, suggesting its involvement in nociceptive pathways .

More recently, KCNK6 has been identified as a critical potassium channel mediating K+ efflux across the plasma membrane, essential for NLRP3 inflammasome activation. This discovery positions KCNK6 as an important component in inflammatory signaling cascades .

Recommended Protocols

For optimal results with KCNK6 antibodies, researchers should consider the following recommendations:

Western Blotting

• Recommended dilutions: 1:500 to 1:2000, depending on the specific antibody and application

• Expected molecular weight: 33-36 kDa for monomeric KCNK6, with potential detection at ~70 kDa for dimeric forms

• Positive control samples: BxPC-3, HT-29, K-562, A-549, 293T cell lines, mouse pancreas, mouse heart

Immunohistochemistry

• Validated for both paraffin-embedded (IHC-p) and frozen (IHC-f) tissue sections

• Blocking and antigen retrieval protocols should be optimized for each specific antibody

Future Perspectives in KCNK6 Antibody Research

The continued development and application of KCNK6 antibodies hold promise for advancing several research areas:

1. Cancer biology: Further investigation of KCNK6's role in breast cancer and potentially other cancer types could lead to new diagnostic markers or therapeutic targets

2. Inflammation and immunity: Given the emerging role of KCNK6 in inflammasome activation, KCNK6 antibodies will be valuable tools for studying inflammatory disorders and potential interventions

3. Neuroscience: The importance of potassium channels in neuronal excitability positions KCNK6 as a subject of interest in neurological and pain research

4. Cardiovascular physiology: KCNK6's expression in cardiac tissue suggests potential roles in heart function and pathology that warrant further exploration with specific antibodies

The development of monoclonal antibodies against KCNK6 with enhanced specificity and diverse applications would further advance these research directions.