kif7 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to KIF7 Protein and Its Antibodies

KIF7 (Kinesin Family Member 7) is a 1,343 amino acid protein expressed in embryonic stem cells, melanotic melanoma, and Jurkat T-cells . As a member of the KIF27 subfamily of kinesin-like proteins, KIF7 contains one kinesin-motor domain and functions as a crucial regulator of the Hedgehog (Hh) signaling pathway . KIF7 participates in this pathway by regulating the proteolysis and stability of GLI transcription factors, making it essential for embryonic development .

The protein exhibits dual functionality as both a negative and positive regulator of Sonic Hedgehog (Shh) and Indian Hedgehog (Ihh) signaling pathways, acting downstream of SMO through both SUFU-dependent and independent mechanisms . KIF7 is particularly noteworthy for its localization to cilia tips, where it controls cilia length and structure . Unlike conventional kinesins, KIF7 is an immotile kinesin that binds to the plus-ends of growing microtubules, reducing growth rates and increasing the frequency of microtubule catastrophe .

KIF7 antibodies have emerged as crucial tools for investigating these functions across various experimental contexts, enabling researchers to visualize protein localization, quantify expression levels, and study protein-protein interactions in both normal development and disease states.

Types of KIF7 Antibodies

KIF7 antibodies are available in various formats to suit different experimental requirements. These antibodies differ in their host species, clonality, conjugation status, and target epitopes.

Classification by Host Species

Host species diversity allows researchers to select antibodies compatible with their experimental design:

Host SpeciesAdvantagesCommon Applications
MouseExcellent for co-staining with rabbit antibodiesImmunohistochemistry, Western blot
RabbitHigh sensitivity, robust signalWestern blot, immunoprecipitation

Mouse-derived KIF7 antibodies include monoclonal variants like A44781, which are specifically designed for immunohistochemistry applications . Rabbit-derived antibodies, such as NBP1-46838 and NBP2-85155, offer broad applicability across multiple techniques including Western blotting .

Classification by Clonality

KIF7 antibodies are available in both monoclonal and polyclonal formats:

Clonality TypeRepresentative ProductsKey Features
MonoclonalA44781 (Mouse) High specificity, consistent lot-to-lot reproducibility
PolyclonalNBP1-46838 (Rabbit) , bs-12388R-Cy7 (Rabbit) Broader epitope recognition, stronger signal

Monoclonal antibodies offer superior specificity for focused applications, while polyclonal antibodies provide enhanced sensitivity for detecting low-abundance targets.

Classification by Conjugation

Various conjugated formats facilitate different detection methods:

Conjugate TypeExample ProductsApplications
UnconjugatedNBP1-46838 , NBP2-85155 Western blot, standard immunoassays
Fluorophore-conjugatedNBP1-46838JF646 (Janelia Fluor 646) , bs-12388R-Cy7 (Cy7) Immunofluorescence, flow cytometry
Biotin-conjugatedAvailable from select suppliers Signal amplification systems

The conjugation state directly influences detection sensitivity and compatibility with specific visualization systems.

Immunogen Information

KIF7 antibodies target different regions of the protein, influencing their specificity and application performance:

Antibody ProductImmunogen RegionTarget SpeciesCatalog Reference
NBP1-46838Region between residues 1225-1275 of human KIF7 (NP_940927.2)Human
NBP2-85155C-terminal region synthetic peptide: RDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGEAGLPHuman
bs-12388R-Cy7KLH conjugated synthetic peptide derived from human KIF7 (range 751-850/1343)Human, Mouse, Rat
A44781Endogenous KIF7 proteinsHuman, Mouse, Rat

This diversity in target epitopes provides researchers with options for detecting different functional domains or isoforms of KIF7.

KIF7 in Hedgehog Signaling Regulation

KIF7 antibodies have been instrumental in elucidating the protein's role in Hedgehog pathway regulation. Research demonstrates that KIF7 localizes to cilia tips, the site of microtubule plus-ends, where it controls cilia length and structure . This localization is crucial for proper Hedgehog signal transduction.

Western blot analysis using KIF7 antibodies revealed that KIF7-deficient lungs contained elevated levels of GLI1 and GLI2 proteins (Hedgehog pathway activators) and reduced expression of GLI3 repressor . Similarly, in KIF7-depleted mouse lung fibroblasts, increased GLI1 and GLI2 protein levels were observed . Nuclear fractionation experiments further demonstrated elevated GLI1 expression in nuclei of KIF7-depleted cells, confirming KIF7's role as a negative regulator of Hedgehog/Gli signaling in fibroblasts of the perinatal lung .

KIF7 in T-cell Development and Normal Immunity

KIF7 antibodies have helped establish that KIF7 is required for normal T-cell development, despite the absence of primary cilia in T-cells . Analysis of Kif7-deficient thymus showed that KIF7-deficiency increases early CD44+CD25+CD4-CD8- thymocyte progenitor populations but reduces differentiation to CD4+CD8+ double positive (DP) cells .

Quantitative RT-PCR experiments validated with KIF7 antibodies demonstrated that Ptch1 expression (a Hedgehog target gene) was significantly higher in Kif7-/- cultures compared to wild-type, while Kif7-/- cells appeared refractory or less sensitive to Hedgehog pathway activation . This indicates that KIF7 is essential for proper interpretation of Hedgehog signals during T-cell development.

KIF7 in Respiratory Airway Development

KIF7 antibodies have facilitated research showing that KIF7 regulates cell proliferation, cellular density, and intracellular signaling within epithelial and mesenchymal cells of the respiratory airway . Immunostaining of E18.5 Kif7 mutant lungs revealed increased numbers of Ki67+ respiratory epithelial cells, suggesting these cells fail to exit the cell cycle properly in the absence of KIF7 .

KIF7 in Growth Plate Chondrocytes

Research employing KIF7 antibodies has demonstrated that KIF7 promotes Hedgehog signaling in growth plate chondrocytes by restricting Suppressor of Fused (Sufu) activity . KIF7 plays a role in the turnover of Sufu and the exclusion of Sufu-Gli complexes from the primary cilium . Experiments showed that halving the dose of Sufu restored normal Hedgehog pathway activity and chondrocyte development in Kif7-null mice, confirming that KIF7's positive role is to restrict Sufu's inhibitory activity .

Ciliary Trafficking and Microtubule Binding

Recent research using KIF7 antibodies has revealed that Hedgehog-induced ciliary trafficking of KIF7 requires intraflagellar transport but not KIF7's microtubule binding capability . Experiments demonstrated that microtubule binding of KIF7 is not required for the increase in KIF7 or Gli localization at the cilium tip in response to Hedgehog signaling . Additionally, the immotile behavior of KIF7 was shown to be essential for preventing ciliary localization of Gli transcription factors in the absence of Hedgehog signaling .

Dual Regulatory Functions in Hedgehog Pathway

KIF7 antibodies have helped elucidate that KIF7 functions as both a negative and positive regulator in the Hedgehog pathway. As a negative regulator, it prevents inappropriate activation of transcriptional activator GLI2 in the absence of ligand . As a positive regulator, it prevents the processing of transcription factor GLI3 into its repressor form . In keratinocytes, KIF7 promotes the dissociation of SUFU-GLI2 complexes, GLI2 nuclear translocation, and Hedgehog signaling activation .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
kif7 antibody; cos2Kinesin-like protein kif7 antibody; Kinesin-like protein costal2 antibody
Target Names
Uniprot No.

Target Background

Function
Kif7 acts downstream of Smo as an intracellular repressor of the hedgehog signaling pathway, primarily through the suppression of Gli1 activity. This inhibitory effect is enhanced in conjunction with the Suppressor of Fused (Sufu) protein. Kif7 positively regulates Gli2a activity by promoting its dissociation from Sufu. It is also involved in the regulation of microtubular dynamics.
Gene References Into Functions
  1. Both OSM-3/KIF17 and COS2/KIF7 exhibit comparable outer segment developmental delays, albeit through independent mechanisms. PMID: 28341548
  2. Our findings indicate that Kif7 interacts with both Gli1 and Gli2a and suggest that it functions to sequester Gli proteins in the cytoplasm, analogous to the regulation of Ci by Cos2 in Drosophila. PMID: 24339784
  3. Zebrafish Costal2 acts as an intracellular repressor of signal transduction. PMID: 15647323
Database Links
Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, KIF27 subfamily
Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, cilium.

Q&A

What is KIF7 and what is its primary function in cellular signaling?

KIF7 (kinesin family member 7) is a microtubule-interacting protein that functions as a core modulator of Hedgehog (Hh) signaling by maintaining the architecture of the primary cilium. This 151 kDa protein (calculated molecular weight) functions in a manner similar to Drosophila Costal2, playing both negative and positive regulatory roles in Sonic Hedgehog (Shh) signal transduction. Without a ligand present, KIF7 localizes to the cilium base where it forms a complex with Gli proteins and other pathway components, promoting the processing of Gli repressors (GliRs) . In response to Hedgehog pathway activation, KIF7 changes its subcellular localization, moving from the base of the cilium to the tip, which may reflect its transition from a negative to positive regulatory role . Interestingly, KIF7 has been found to function in T-cell development despite the fact that T-cells lack primary cilia, indicating additional roles beyond ciliary function .

What applications can KIF7 antibodies be used for in research?

KIF7 antibodies have been validated for multiple applications in research settings. According to published literature and technical specifications, KIF7 antibodies can be reliably used for:

  • Western Blot (WB) analysis to detect endogenous KIF7 protein

  • Immunoprecipitation (IP) to isolate KIF7 and its associated protein complexes

  • Immunohistochemistry (IHC) to examine tissue localization patterns

  • Immunofluorescence (IF) to investigate subcellular localization

  • ELISA-based applications

These applications have been demonstrated in numerous publications, with at least 5 publications documenting WB applications, 2 publications reporting IF applications, and 1 publication each for IHC and knockdown/knockout (KD/KO) validation .

What are the recommended dilutions and experimental conditions for KIF7 antibody use?

Optimal dilutions for KIF7 antibody applications vary by technique. Based on technical validation data:

ApplicationRecommended DilutionNotes
Western Blot (WB)1:500-1:2000Sample-dependent optimization recommended
Immunoprecipitation (IP)0.5-4.0 μg for 1.0-3.0 mg of total protein lysateTitration recommended for optimal results

KIF7 antibodies should be stored at -20°C in appropriate buffer conditions (PBS with 0.02% sodium azide and 50% glycerol, pH 7.3). They remain stable for one year after shipment under these conditions, and aliquoting is generally unnecessary for -20°C storage . When designing experiments, researchers should note that the observed molecular weight of KIF7 is approximately 140 kDa, slightly different from the calculated molecular weight of 151 kDa .

Which cell types and tissues have been validated for KIF7 antibody reactivity?

KIF7 antibodies have demonstrated reactivity primarily with human samples, although cited reactivity includes both human and mouse systems . Positive Western blot and immunoprecipitation detection has been specifically validated in HEK-293 cells . In developmental studies, KIF7 has been detected in various thymocyte subsets throughout T-cell development, with expression patterns showing developmental regulation—relatively low expression in the DN1 population, upregulation in DN2 and DN3 populations, peak expression in DN4 cells, and downregulation in DP and SP populations . The antibody's effectiveness in other cell types should be validated by researchers before proceeding with extensive studies.

How can researchers effectively investigate KIF7's dual role in Hedgehog pathway regulation?

Studying KIF7's dual regulatory function requires specialized experimental approaches that can distinguish between its negative and positive roles. Genetic experiments in mouse models have revealed that Kif7 acts as both a negative regulator that prevents inappropriate activation of Gli2 in the absence of ligand, and as a positive regulator that promotes Shh signaling under certain conditions .

To effectively study this duality, researchers should:

  • Design loss-of-function experiments using both complete knockout models and conditional inactivation approaches to observe context-specific effects

  • Implement double-mutant analyses similar to the Kif7;Ptch1 and Kif7;Dync2h1 double mutants described in the literature, which revealed KIF7's positive regulatory role

  • Employ fluorescently tagged KIF7 constructs (such as Kif7-eGFP) to track subcellular localization changes in response to pathway activation

  • Combine these approaches with Gli reporter assays to measure pathway activity

The subcellular localization of KIF7 appears critical to its function—KIF7-eGFP is enriched at the base of the cilium when the pathway is inactive but moves to the cilium tip upon pathway activation. This suggests that KIF7's negative regulatory activity occurs at the cilium base, while its positive role takes place at the tip .

What are the methodological considerations for studying KIF7 in non-ciliated cells like T-cells?

While KIF7 is primarily studied in the context of ciliary function, research has demonstrated its expression and functional importance in non-ciliated cells such as T-cells . When designing experiments to study KIF7 in T-cells, researchers should consider:

  • Expression analysis across developmental stages: RT-PCR analysis shows that KIF7 expression varies significantly across T-cell developmental stages, with peak expression observed in DN4 cells and downregulation in DP and SP populations .

  • Functional readouts: In T-cells, KIF7 deficiency affects:

    • The transition from CD44+CD25+CD4-CD8- (DN) thymocyte progenitors to CD4+CD8+ double positive (DP) cells

    • Maturation to CD8 lineage cells

    • Expression of CD5 (a marker correlating with TCR signal strength)

    • T-cell activation in response to CD3/CD28 stimulation

    • Expression of Hedgehog target genes like Ptch1

  • Technical approaches:

    • Fetal thymic organ culture (FTOC) systems to study T-cell development in vitro

    • Flow cytometric analysis of developmental markers (CD4, CD8, CD3, CD5)

    • Radiation chimeras to distinguish thymocyte-intrinsic effects from microenvironment effects

    • Treatment with recombinant proteins (rShh, rHhip) to modulate Hedgehog signaling

Interestingly, KIF7-deficient thymocytes showed higher basal expression of the Hedgehog target gene Ptch1 than wild-type cells but were less responsive to treatment with recombinant Shh, suggesting that KIF7-deficient cells are unable to properly interpret changes in Hedgehog signaling .

How should researchers approach KIF7 antibody validation in experimental systems?

Rigorous antibody validation is essential for reliable research outcomes. For KIF7 antibodies, comprehensive validation should include:

  • Specificity controls:

    • Testing in KIF7 knockout/knockdown systems (as documented in at least one publication )

    • Using multiple antibodies targeting different KIF7 epitopes to confirm signal consistency

    • Peptide competition assays to confirm binding specificity

  • Validation across applications:

    • Confirming expected molecular weight (approximately 140 kDa) in Western blotting

    • Verifying subcellular localization patterns in immunofluorescence matches known KIF7 biology (ciliary base localization in unstimulated cells, translocation to ciliary tip upon Shh stimulation)

    • Cross-validation between techniques (e.g., confirming WB results with IP)

  • Species-specific considerations:

    • While KIF7 antibodies primarily show reactivity with human samples, they have been cited in mouse studies as well

    • Species-specific validation is necessary when extending to new model systems

  • Functional correlation:

    • Correlating antibody detection with functional readouts (e.g., Hedgehog pathway activation measured by Gli reporter assays or Ptch1 expression)

What approaches can reveal the interaction between KIF7 and Gli proteins in Hedgehog signaling?

Investigating KIF7-Gli interactions is critical for understanding Hedgehog pathway regulation. Based on research findings, zebrafish Kif7 binds Gli proteins directly , and in mouse models, Kif7 negatively regulates the pathway by preventing inappropriate activation of Gli2 in the absence of ligand . Researchers can employ the following approaches to study these interactions:

  • Biochemical interaction studies:

    • Co-immunoprecipitation using KIF7 antibodies to pull down associated Gli proteins

    • Reciprocal IP with Gli antibodies to confirm interactions

    • Proximity ligation assays to detect protein-protein interactions in situ

  • Functional interaction studies:

    • Genetic epistasis experiments combining Kif7 and Gli mutations

    • Analysis of Gli processing (full-length vs. repressor forms) in Kif7 wild-type vs. mutant contexts

    • Quantification of Gli protein levels and subcellular distribution in response to Kif7 manipulation

  • Subcellular localization studies:

    • Co-localization analysis of KIF7 and Gli proteins at the base and tip of cilia

    • Live imaging using fluorescently tagged proteins to track dynamics

    • Studying changes in localization patterns in response to pathway activation

Research suggests that in the absence of pathway activation, KIF7 at the base of the cilium may negatively regulate the pathway by targeting Gli2 away from the cilium or promoting Gli2 turnover at the basal body, where proteasomes are enriched . Understanding these dynamics requires sophisticated imaging and biochemical approaches.

How can researchers effectively study KIF7's function in neural development using antibody-based approaches?

KIF7 plays critical roles in neural development through Hedgehog pathway regulation. Loss of Kif7 activity causes expansion of ventral neural cell types in the neural tube due to expanded expression of Shh target genes . Investigating these developmental roles requires specialized approaches:

  • Immunohistochemical analysis:

    • Neural tube patterning studies using markers for specific neural progenitor domains

    • Co-staining with KIF7 antibodies and neural cell type markers

    • Detailed analysis of ventral neural cell populations in wild-type versus Kif7 mutant tissues

  • Biochemical analyses:

    • Quantification of Gli3 repressor levels, which are decreased in Kif7 mutant embryos

    • Analysis of Gli2 activation status in different neural tube domains

    • Chromatin immunoprecipitation to study Gli binding to target genes in Kif7 mutant contexts

  • Functional studies:

    • Ex vivo neural tube explant cultures treated with recombinant Shh and analyzed with KIF7 antibodies

    • Rescue experiments in Kif7-deficient systems

    • Temporal analysis of KIF7 expression and localization during neural development

Current research indicates that Kif7 cooperates with Gli3 in restricting Shh activity and ventral fates in the neural tube, suggesting complex interactions that can be revealed through careful experimental design and antibody-based detection methods .

What are common pitfalls in KIF7 antibody-based experiments and how can researchers avoid them?

Working with KIF7 antibodies presents several technical challenges that researchers should anticipate and address:

  • Detection sensitivity issues:

    • The dual role of KIF7 as both a negative and positive regulator may complicate interpretation of results

    • Cell-based reporter assays may not be sensitive enough to detect subtle changes in pathway activity that are clear in embryonic systems

    • Consider using more sensitive readouts or in vivo systems when possible

  • Sample preparation considerations:

    • Proper preservation of subcellular structures, especially primary cilia, is critical for accurate localization studies

    • Fixation methods should be optimized to maintain ciliary structures while preserving antibody epitopes

    • For ciliary localization studies, consider using both ciliary markers (such as acetylated tubulin) alongside KIF7 staining

  • Control experiments:

    • Include KIF7 knockout/knockdown controls whenever possible

    • For T-cell experiments, consider that KIF7-deficient thymocytes respond differently to Hedgehog modulation than wild-type cells

    • Validate findings across multiple experimental systems when possible

  • Interpretation challenges:

    • The observed molecular weight of KIF7 (140 kDa) differs slightly from the calculated value (151 kDa) , which may cause confusion in Western blot analysis

    • KIF7's function differs between ciliated and non-ciliated cells, requiring context-specific experimental design and interpretation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.