klhl36 Antibody

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

KLHL36 is a 613-amino acid protein containing characteristic Kelch repeat motifs that facilitate substrate recognition in ubiquitin-mediated proteolysis . The KLHL36 antibody (HPA023423) is a polyclonal reagent validated for multiple applications, including:

  • Immunohistochemistry (1:200–1:500 dilution)

  • Immunoblotting (0.04–0.4 μg/mL)

  • Immunofluorescence (0.25–2 μg/mL) .

It targets the immunogen sequence:
EDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPDFLQNVSMQKLCVYLSSSEVQRECEHDLLQAALQWLTQQPEREAHARQVLENIHFPLIPKNDLLH .

Antibody Validation and Applications

The KLHL36 antibody (HPA023423) is part of the Prestige Antibodies® line, characterized by:

  • Extensive validation across 44 normal and 20 cancerous tissues .

  • Protein array testing against 364 recombinant human proteins to ensure specificity .

  • Subcellular localization data from the Human Protein Atlas, including immunofluorescence images .

Clinical and Research Implications

  • Diagnostic Potential: KLHL36 antibody’s reactivity in immunohistochemistry supports its use in profiling KLHL36 expression in tumors vs. normal tissues .

  • Mechanistic Studies: Recombinant KLHL36 proteins (e.g., Strep Tag variants) enable substrate interaction assays to identify ubiquitination targets .

  • Limitations: No peer-reviewed studies directly link KLHL36 to specific diseases, highlighting a gap in current research .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
klhl36 antibody; zgc:110268Kelch-like protein 36 antibody
Target Names
klhl36
Uniprot No.

Target Background

Function
KLHL36 is a probable substrate-specific adapter of an E3 ubiquitin-protein ligase complex. It mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Database Links

Q&A

What is KLHL36 and why is it important in research?

KLHL36 (Kelch-like family member 36) is a protein encoded by the KLHL36 gene in humans, also known as C16orf44 . It belongs to the Kelch-like protein family, characterized by containing kelch repeat domains. While the specific biological function remains under investigation, it's expressed across various human tissues and may play roles in protein-protein interactions through its structural domains . Research into KLHL36 contributes to our understanding of cellular pathways potentially involving ubiquitination processes and protein degradation, given the structural similarity to other kelch family proteins.

What is the tissue expression pattern of KLHL36?

According to The Human Protein Atlas data, KLHL36 shows variable expression across human tissues . The protein is detected in multiple organs including brain regions (hippocampal formation, amygdala, cerebral cortex, cerebellum), endocrine tissues (thyroid, adrenal gland), digestive system (stomach, intestines, liver, pancreas), reproductive system (testis, prostate, breast), and immune tissues (bone marrow, lymph nodes) . This widespread distribution suggests potential functional roles across multiple physiological systems, making KLHL36 antibodies valuable tools for comparative tissue expression studies.

What types of KLHL36 antibodies are available for research?

Several types of KLHL36 antibodies are available for research applications:

Antibody TypeHost SpeciesClonalityEpitope RegionKey Applications
Anti-KLHL36 (E-2)MouseMonoclonal IgG1 κAmino acids 3-29WB, IP, IF, IHC(P), ELISA
Anti-KLHL36 (F-7)MouseMonoclonal IgG1 κAmino acids 451-540WB, IP, IF, ELISA
Anti-KLHL36RabbitPolyclonalSynthetic peptideIHC

These antibodies provide researchers with options for different experimental approaches based on epitope recognition and application requirements .

How do I select the optimal KLHL36 antibody for my experimental design?

Selection of the appropriate KLHL36 antibody should be based on several critical factors:

  • Experimental application: Different antibodies show varying performance in applications like Western blot, immunohistochemistry, or immunofluorescence. For instance, the E-2 monoclonal antibody is validated for WB, IP, IF, IHC(P), and ELISA, making it versatile for multiple applications .

  • Species compatibility: Ensure the antibody recognizes KLHL36 in your species of interest. The available antibodies recognize human KLHL36, with some cross-reactivity to mouse and rat orthologues .

  • Epitope location: Different antibodies target distinct regions of KLHL36. When studying protein interactions or domains, choose an antibody whose epitope doesn't interfere with the region of interest.

  • Validation status: Prioritize antibodies with enhanced validation through orthogonal methods like siRNA knockdown or independent antibody validation .

  • Application-specific optimization: For quantitative studies, monoclonal antibodies may provide more consistent results across experiments.

What validation methods should I use to confirm KLHL36 antibody specificity?

To ensure experimental reliability, KLHL36 antibody validation should include multiple approaches:

  • Standard validation: Compare antibody performance with known KLHL36 expression patterns documented in repositories like UniProtKB/Swiss-Prot .

  • Enhanced validation techniques:

    • siRNA knockdown: Demonstrate reduced antibody signal following KLHL36 downregulation

    • Independent antibody validation: Compare staining patterns using antibodies targeting different KLHL36 epitopes

    • Orthogonal validation: Correlate protein detection with mRNA expression levels

    • Western blot analysis: Confirm detection of a single band at the expected molecular weight

    • CRISPR/Cas9 knockout controls: Use KLHL36 knockout samples as negative controls

The Human Protein Atlas implements rigorous validation standards that can serve as a methodological guide, resulting in confidence scores of Enhanced, Supported, Approved, or Uncertain .

What are the optimal conditions for KLHL36 immunohistochemistry?

For successful KLHL36 immunohistochemistry:

  • Fixation: Standard formalin fixation and paraffin embedding protocols are typically suitable, though optimization may be required for specific tissues.

  • Antigen retrieval: Heat-induced epitope retrieval methods are commonly used, but specific buffer conditions should be optimized based on preliminary experiments.

  • Antibody concentration: Initial titration experiments should determine optimal dilution, typically starting with manufacturer recommendations.

  • Incubation conditions: Most protocols use overnight incubation at 4°C for primary antibody, but this can be optimized.

  • Detection system: For polyclonal antibodies like those from SAB Biotech, sensitive detection systems may enhance visualization .

  • Controls: Include both positive control tissues known to express KLHL36 (based on Human Protein Atlas data) and negative controls (antibody omission and non-expressing tissues) .

How can I design experiments to investigate KLHL36 protein interactions?

To study KLHL36 protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Use KLHL36 antibodies like E-2 or F-7 that are validated for immunoprecipitation

    • Optimize lysis conditions to preserve protein complexes

    • Confirm specificity using KLHL36 knockdown or knockout controls

    • Analyze precipitated complexes by mass spectrometry or Western blot for suspected partners

  • Proximity ligation assay (PLA):

    • Utilize KLHL36 antibodies in combination with antibodies against suspected interaction partners

    • Ensure antibodies originate from different host species for effective PLA detection

    • Include appropriate controls to confirm signal specificity

  • CRISPR-based approaches:

    • Implement KLHL36 CRISPR/Cas9 knockout systems to assess the functional significance of identified interactions

    • The available CRISPR/Cas9 KO Plasmid, HDR Plasmid, and Double Nickase Plasmid systems provide tools for genetic manipulation

  • Affinity purification with tagged KLHL36:

    • Express tagged versions of KLHL36 to facilitate pulldown experiments

    • Compare results with endogenous KLHL36 immunoprecipitation to validate physiological relevance

How do I troubleshoot inconsistent KLHL36 antibody staining patterns?

When encountering inconsistent KLHL36 antibody results:

  • Antibody validation issues:

    • Verify antibody specificity using the methods described in question 2.2

    • Consider testing multiple antibodies targeting different KLHL36 epitopes

    • Review antibody validation scores and documentation from providers

  • Technical parameters:

    • Optimize fixation conditions for your specific tissue or cell type

    • Adjust antigen retrieval methods (heat-induced vs. enzymatic)

    • Titrate antibody concentration to achieve optimal signal-to-noise ratio

    • Modify incubation times and temperatures

  • Sample preparation:

    • Ensure consistent sample handling and processing

    • Minimize time between tissue collection and fixation

    • Control for variables like fixation duration and processing schedules

  • Controls:

    • Include KLHL36 knockdown or knockout samples as negative controls

    • Use tissues with known KLHL36 expression as positive controls

    • Implement isotype controls to assess non-specific binding

What approaches can I use for quantitative analysis of KLHL36 expression?

For quantitative KLHL36 expression analysis:

  • Western blot quantification:

    • Use monoclonal antibodies for consistent detection

    • Implement appropriate loading controls

    • Apply densitometry analysis with statistical validation

    • Include standard curves with recombinant KLHL36 for absolute quantification

  • Immunohistochemistry quantification:

    • Use digital pathology approaches with consistent staining protocols

    • Apply automated image analysis algorithms to quantify staining intensity

    • Score nuclear vs. cytoplasmic localization separately if relevant

    • Compare results across multiple tissue samples and biological replicates

  • Flow cytometry:

    • Optimize fixation and permeabilization conditions for intracellular KLHL36 detection

    • Include appropriate fluorescence minus one (FMO) controls

    • Calibrate with quantitative beads for absolute protein quantification

  • Proteomics approaches:

    • Use immunoprecipitation followed by mass spectrometry

    • Implement stable isotope labeling techniques for comparative quantification

How can KLHL36 expression be correlated with clinical outcomes in disease studies?

To correlate KLHL36 expression with clinical outcomes:

  • Tissue microarray analysis:

    • Perform immunohistochemistry with validated KLHL36 antibodies on disease tissue arrays

    • Implement standardized scoring systems for expression quantification

    • Correlate expression patterns with clinical parameters and patient outcomes

  • Biomarker development methodology:

    • Follow a structured approach similar to that used for pancreatic adenocarcinoma (PAAD) marker development

    • Integrate KLHL36 expression data with other molecular markers for improved prognostic models

    • Validate findings across independent patient cohorts

  • Multivariate analysis:

    • Control for confounding clinical variables

    • Incorporate KLHL36 expression into Cox proportional hazards models

    • Determine independent prognostic significance through regression analysis

  • Mechanistic validation:

    • Perform functional studies in disease-relevant cell lines using KLHL36 genetic manipulation tools

    • Assess impact on disease-associated cellular phenotypes

What experimental designs are appropriate for studying KLHL36 in disease pathogenesis?

For investigating KLHL36 in disease contexts:

  • Expression profiling across disease progression:

    • Compare KLHL36 levels across disease stages using antibody-based detection methods

    • Include appropriate controls and reference tissues from the Human Protein Atlas

    • Correlate with other established disease markers

  • Genetic manipulation studies:

    • Utilize KLHL36 CRISPR/Cas9 KO or activation systems in disease-relevant cell models

    • Assess impact on disease-related phenotypes and signaling pathways

    • Perform rescue experiments to confirm specificity

  • Animal model studies:

    • Develop conditional knockout models using available genetic tools

    • Apply KLHL36 antibodies for tissue-specific expression analysis

    • Correlate phenotypic changes with molecular mechanisms

  • Patient-derived models:

    • Establish patient-derived xenografts or organoids

    • Profile KLHL36 expression and function in these models

    • Test therapeutic approaches targeting KLHL36-related pathways

How can multiplexed imaging techniques be applied to KLHL36 research?

For multiplexed KLHL36 analysis:

  • Multiplex immunofluorescence:

    • Combine KLHL36 antibodies with markers of cellular compartments or interacting proteins

    • Utilize spectral unmixing for simultaneous detection of multiple targets

    • Implement cyclic immunofluorescence for expanded marker panels

  • Mass cytometry (CyTOF):

    • Label KLHL36 antibodies with rare earth metals

    • Integrate with other protein markers for high-dimensional analysis

    • Apply clustering algorithms to identify cell populations based on KLHL36 expression patterns

  • Spatial transcriptomics integration:

    • Correlate KLHL36 protein expression with spatial mRNA distribution

    • Develop computational methods to integrate protein and transcript data

    • Map KLHL36 expression in the context of tissue microenvironments

  • Validation considerations:

    • Verify antibody performance in multiplexed formats

    • Establish controls for autofluorescence and spectral overlap

    • Confirm staining patterns match those observed in single-antibody experiments

What are the considerations for using KLHL36 genetic modification tools alongside antibody-based detection?

When combining genetic modification with antibody detection:

  • CRISPR/Cas9 knockout validation:

    • Use KLHL36 CRISPR/Cas9 KO Plasmids to create knockout cell lines

    • Apply KLHL36 antibodies to confirm complete protein elimination

    • Include partial knockdown controls to assess antibody sensitivity

  • Gene activation studies:

    • Implement KLHL36 CRISPR Activation Plasmids or Lentiviral Activation Particles

    • Quantify increased expression using calibrated antibody-based methods

    • Correlate protein levels with phenotypic changes

  • Experimental design considerations:

    • Include appropriate controls for each genetic modification

    • Maintain consistent experimental conditions when comparing different modifications

    • Account for potential compensatory mechanisms in knockout models

  • Clonal variation management:

    • Analyze multiple clones to account for off-target effects

    • Validate findings using independent genetic approaches

    • Combine with rescue experiments to confirm specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.