KLHL36 is a 613-amino acid protein containing characteristic Kelch repeat motifs that facilitate substrate recognition in ubiquitin-mediated proteolysis . The KLHL36 antibody (HPA023423) is a polyclonal reagent validated for multiple applications, including:
Immunohistochemistry (1:200–1:500 dilution)
Immunoblotting (0.04–0.4 μg/mL)
It targets the immunogen sequence:
EDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPDFLQNVSMQKLCVYLSSSEVQRECEHDLLQAALQWLTQQPEREAHARQVLENIHFPLIPKNDLLH .
The KLHL36 antibody (HPA023423) is part of the Prestige Antibodies® line, characterized by:
Extensive validation across 44 normal and 20 cancerous tissues .
Protein array testing against 364 recombinant human proteins to ensure specificity .
Subcellular localization data from the Human Protein Atlas, including immunofluorescence images .
Diagnostic Potential: KLHL36 antibody’s reactivity in immunohistochemistry supports its use in profiling KLHL36 expression in tumors vs. normal tissues .
Mechanistic Studies: Recombinant KLHL36 proteins (e.g., Strep Tag variants) enable substrate interaction assays to identify ubiquitination targets .
Limitations: No peer-reviewed studies directly link KLHL36 to specific diseases, highlighting a gap in current research .
KLHL36 (Kelch-like family member 36) is a protein encoded by the KLHL36 gene in humans, also known as C16orf44 . It belongs to the Kelch-like protein family, characterized by containing kelch repeat domains. While the specific biological function remains under investigation, it's expressed across various human tissues and may play roles in protein-protein interactions through its structural domains . Research into KLHL36 contributes to our understanding of cellular pathways potentially involving ubiquitination processes and protein degradation, given the structural similarity to other kelch family proteins.
According to The Human Protein Atlas data, KLHL36 shows variable expression across human tissues . The protein is detected in multiple organs including brain regions (hippocampal formation, amygdala, cerebral cortex, cerebellum), endocrine tissues (thyroid, adrenal gland), digestive system (stomach, intestines, liver, pancreas), reproductive system (testis, prostate, breast), and immune tissues (bone marrow, lymph nodes) . This widespread distribution suggests potential functional roles across multiple physiological systems, making KLHL36 antibodies valuable tools for comparative tissue expression studies.
Several types of KLHL36 antibodies are available for research applications:
| Antibody Type | Host Species | Clonality | Epitope Region | Key Applications |
|---|---|---|---|---|
| Anti-KLHL36 (E-2) | Mouse | Monoclonal IgG1 κ | Amino acids 3-29 | WB, IP, IF, IHC(P), ELISA |
| Anti-KLHL36 (F-7) | Mouse | Monoclonal IgG1 κ | Amino acids 451-540 | WB, IP, IF, ELISA |
| Anti-KLHL36 | Rabbit | Polyclonal | Synthetic peptide | IHC |
These antibodies provide researchers with options for different experimental approaches based on epitope recognition and application requirements .
Selection of the appropriate KLHL36 antibody should be based on several critical factors:
Experimental application: Different antibodies show varying performance in applications like Western blot, immunohistochemistry, or immunofluorescence. For instance, the E-2 monoclonal antibody is validated for WB, IP, IF, IHC(P), and ELISA, making it versatile for multiple applications .
Species compatibility: Ensure the antibody recognizes KLHL36 in your species of interest. The available antibodies recognize human KLHL36, with some cross-reactivity to mouse and rat orthologues .
Epitope location: Different antibodies target distinct regions of KLHL36. When studying protein interactions or domains, choose an antibody whose epitope doesn't interfere with the region of interest.
Validation status: Prioritize antibodies with enhanced validation through orthogonal methods like siRNA knockdown or independent antibody validation .
Application-specific optimization: For quantitative studies, monoclonal antibodies may provide more consistent results across experiments.
To ensure experimental reliability, KLHL36 antibody validation should include multiple approaches:
Standard validation: Compare antibody performance with known KLHL36 expression patterns documented in repositories like UniProtKB/Swiss-Prot .
Enhanced validation techniques:
siRNA knockdown: Demonstrate reduced antibody signal following KLHL36 downregulation
Independent antibody validation: Compare staining patterns using antibodies targeting different KLHL36 epitopes
Orthogonal validation: Correlate protein detection with mRNA expression levels
Western blot analysis: Confirm detection of a single band at the expected molecular weight
CRISPR/Cas9 knockout controls: Use KLHL36 knockout samples as negative controls
The Human Protein Atlas implements rigorous validation standards that can serve as a methodological guide, resulting in confidence scores of Enhanced, Supported, Approved, or Uncertain .
For successful KLHL36 immunohistochemistry:
Fixation: Standard formalin fixation and paraffin embedding protocols are typically suitable, though optimization may be required for specific tissues.
Antigen retrieval: Heat-induced epitope retrieval methods are commonly used, but specific buffer conditions should be optimized based on preliminary experiments.
Antibody concentration: Initial titration experiments should determine optimal dilution, typically starting with manufacturer recommendations.
Incubation conditions: Most protocols use overnight incubation at 4°C for primary antibody, but this can be optimized.
Detection system: For polyclonal antibodies like those from SAB Biotech, sensitive detection systems may enhance visualization .
Controls: Include both positive control tissues known to express KLHL36 (based on Human Protein Atlas data) and negative controls (antibody omission and non-expressing tissues) .
To study KLHL36 protein interactions:
Co-immunoprecipitation (Co-IP):
Proximity ligation assay (PLA):
Utilize KLHL36 antibodies in combination with antibodies against suspected interaction partners
Ensure antibodies originate from different host species for effective PLA detection
Include appropriate controls to confirm signal specificity
CRISPR-based approaches:
Affinity purification with tagged KLHL36:
Express tagged versions of KLHL36 to facilitate pulldown experiments
Compare results with endogenous KLHL36 immunoprecipitation to validate physiological relevance
When encountering inconsistent KLHL36 antibody results:
Antibody validation issues:
Technical parameters:
Optimize fixation conditions for your specific tissue or cell type
Adjust antigen retrieval methods (heat-induced vs. enzymatic)
Titrate antibody concentration to achieve optimal signal-to-noise ratio
Modify incubation times and temperatures
Sample preparation:
Ensure consistent sample handling and processing
Minimize time between tissue collection and fixation
Control for variables like fixation duration and processing schedules
Controls:
For quantitative KLHL36 expression analysis:
Western blot quantification:
Use monoclonal antibodies for consistent detection
Implement appropriate loading controls
Apply densitometry analysis with statistical validation
Include standard curves with recombinant KLHL36 for absolute quantification
Immunohistochemistry quantification:
Use digital pathology approaches with consistent staining protocols
Apply automated image analysis algorithms to quantify staining intensity
Score nuclear vs. cytoplasmic localization separately if relevant
Compare results across multiple tissue samples and biological replicates
Flow cytometry:
Optimize fixation and permeabilization conditions for intracellular KLHL36 detection
Include appropriate fluorescence minus one (FMO) controls
Calibrate with quantitative beads for absolute protein quantification
Proteomics approaches:
Use immunoprecipitation followed by mass spectrometry
Implement stable isotope labeling techniques for comparative quantification
To correlate KLHL36 expression with clinical outcomes:
Tissue microarray analysis:
Perform immunohistochemistry with validated KLHL36 antibodies on disease tissue arrays
Implement standardized scoring systems for expression quantification
Correlate expression patterns with clinical parameters and patient outcomes
Biomarker development methodology:
Multivariate analysis:
Control for confounding clinical variables
Incorporate KLHL36 expression into Cox proportional hazards models
Determine independent prognostic significance through regression analysis
Mechanistic validation:
For investigating KLHL36 in disease contexts:
Expression profiling across disease progression:
Genetic manipulation studies:
Animal model studies:
Develop conditional knockout models using available genetic tools
Apply KLHL36 antibodies for tissue-specific expression analysis
Correlate phenotypic changes with molecular mechanisms
Patient-derived models:
Establish patient-derived xenografts or organoids
Profile KLHL36 expression and function in these models
Test therapeutic approaches targeting KLHL36-related pathways
For multiplexed KLHL36 analysis:
Multiplex immunofluorescence:
Combine KLHL36 antibodies with markers of cellular compartments or interacting proteins
Utilize spectral unmixing for simultaneous detection of multiple targets
Implement cyclic immunofluorescence for expanded marker panels
Mass cytometry (CyTOF):
Label KLHL36 antibodies with rare earth metals
Integrate with other protein markers for high-dimensional analysis
Apply clustering algorithms to identify cell populations based on KLHL36 expression patterns
Spatial transcriptomics integration:
Correlate KLHL36 protein expression with spatial mRNA distribution
Develop computational methods to integrate protein and transcript data
Map KLHL36 expression in the context of tissue microenvironments
Validation considerations:
Verify antibody performance in multiplexed formats
Establish controls for autofluorescence and spectral overlap
Confirm staining patterns match those observed in single-antibody experiments
When combining genetic modification with antibody detection:
CRISPR/Cas9 knockout validation:
Gene activation studies:
Experimental design considerations:
Include appropriate controls for each genetic modification
Maintain consistent experimental conditions when comparing different modifications
Account for potential compensatory mechanisms in knockout models
Clonal variation management:
Analyze multiple clones to account for off-target effects
Validate findings using independent genetic approaches
Combine with rescue experiments to confirm specificity