KLRB1 Antibody

What is KLRB1 and why is it significant in immunological research?

KLRB1 (Killer cell lectin-like receptor subfamily B, member 1), also known as CD161, is a type II transmembrane lectin-like receptor belonging to the killer cell lectin-like receptor (KLR) family. It exists as a homodimeric cell surface protein comprising two chains with molecular weights ranging from 40-44kDa. KLRB1 is primarily expressed on natural killer (NK) cells and natural killer T (NKT) cells, where it plays an inhibitory role in NK cell function. Additionally, it appears on various T cell subsets, including T regulatory cells (Tregs), memory/effector CD4+ T cells, and CD8+ T cells .

The significance of KLRB1 in immunological research stems from its role in regulating NK cell cytotoxicity and interferon-gamma secretion by binding to its ligand CLEC2D/LLT1. Furthermore, KLRB1 is associated with Th17 cells, as IL-17A+ cells are contained within the CD161+ fraction of CD4+ T cells, making KLRB1 (in combination with CCR6) an important marker for Th17 cell enrichment . This makes KLRB1 antibodies valuable tools for studying innate and adaptive immune responses in various contexts, including autoimmune diseases, cancer immunology, and infectious disease research.

What are the structural and functional properties of KLRB1 protein?

KLRB1 protein possesses several distinct structural domains that contribute to its functionality:

• Extracellular domain: Contains characteristic C-type lectin motifs that enable carbohydrate binding. KLRB1 specifically binds to terminal carbohydrate Gal-alpha(1,3)Gal epitope and to the N-acetyllactosamine epitope .

• Transmembrane domain: Anchors the protein in the cell membrane, with KLRB1 being classified as a type II membrane protein due to its external C terminus .

• Cytoplasmic domain: Involved in signal transduction following receptor engagement.

Functionally, KLRB1 acts as an inhibitory receptor on NK cells. When activated, it triggers multiple cellular processes including:

• Stimulation of acid sphingomyelinase (SMPD1)

• Increase in intracellular ceramide

• Activation of AKT1/PKB and RPS6KA1/RSK1 kinase pathways

• Promotion of T cell proliferation when stimulated with anti-CD3

KLRB1 also serves as a lectin receptor that interacts with specific carbohydrate structures and proteins. Its binding to CLEC2D/LLT1 ligand leads to inhibition of NK cell-mediated cytotoxicity and interferon-gamma secretion in target cells, thus playing a crucial role in modulating immune responses .

How do I select the appropriate KLRB1 antibody for my specific research application?

Selecting the appropriate KLRB1 antibody requires careful consideration of several experimental parameters:

• Application compatibility: Different antibodies are optimized for specific techniques. For instance, while the polyclonal antibody A37904 is validated for Western blot (WB) and immunohistochemistry (IHC), the monoclonal HP-3G10 antibody is specifically recommended for flow cytometry . Review validation data for your intended application before selection.

• Species reactivity: Ensure the antibody recognizes KLRB1 from your species of interest. Some antibodies, like HP-3G10, demonstrate cross-reactivity with non-human primates (Baboon, Chimpanzee, Rhesus) , while others may be human-specific or react with mouse KLRB1 .

• Clonality considerations:

  • Monoclonal antibodies (e.g., clone 2F3, HP-3G10) offer high specificity for a single epitope, providing consistent results across experiments .

  • Polyclonal antibodies recognize multiple epitopes, potentially providing stronger signals but with batch-to-batch variation .

• Conjugation requirements: For direct detection methods like flow cytometry, consider pre-conjugated antibodies (e.g., HP-3G10 with PerCP/Cy5.5) . For applications requiring additional flexibility, unconjugated antibodies allow custom labeling or detection schemes.

• Epitope location: The epitope recognized by the antibody may impact its utility in certain applications. For example, HPA039113 targets a specific sequence (KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH) , which might be preferable for certain assays.

Reviewing validation data (western blot images, IHC staining patterns, flow cytometry profiles) provided by manufacturers will help ensure the antibody performs as expected in your experimental system.

What are the optimal protocols for detecting KLRB1 expression using flow cytometry?

Flow cytometry is the gold standard for detecting KLRB1/CD161 on immune cells. For optimal results, follow these methodological guidelines:

Sample Preparation Protocol:

• Cell isolation: Isolate peripheral blood mononuclear cells (PBMCs) using density gradient centrifugation (Ficoll-Paque) or obtain single-cell suspensions from tissues of interest.

• Cell count and viability assessment: Adjust concentration to 1-5×10^6 cells per staining reaction with >90% viability.

• Blocking step: Incubate cells with 2% normal serum (matched to secondary antibody species if using indirect staining) and Fc receptor blocking reagent for 15-20 minutes at 4°C to minimize non-specific binding.

• Antibody staining:

  • When using conjugated antibodies like HP-3G10 PerCP/Cy5.5, add 5μl per 10^6 cells and incubate for 30 minutes at 4°C in the dark .

  • Include appropriate isotype controls (e.g., Mouse IgG1 Kappa) at the same concentration.

• Multicolor panel design: Combine KLRB1 antibody with markers for:

  • NK cells (CD3-CD56+)

  • NKT cells (CD3+CD56+)

  • T cell subsets (CD3+CD4+ or CD3+CD8+)

  • For Th17 detection, include CCR6 as KLRB1/CD161 is often used in combination with CCR6 for Th17 cell enrichment .

• Washing and analysis: Perform two washes with buffer (PBS with 2% FBS), resuspend in 300-500μl buffer with viability dye, and analyze promptly.

Technical Considerations:

• Set PMT voltages using unstained controls and single-stained compensation beads.

• Include Fluorescence Minus One (FMO) controls to accurately determine KLRB1 positivity thresholds.

• When analyzing data, first gate on lymphocytes based on FSC/SSC, exclude doublets and dead cells, then examine KLRB1 expression on relevant immune cell populations.

This protocol can be adapted for phenotyping cells from various tissues including peripheral blood, lymph nodes, spleen, and infiltrating immune cells in pathological specimens.

What are the best practices for using KLRB1 antibodies in Western blot applications?

For successful Western blot detection of KLRB1 protein, follow these methodological guidelines:

Sample Preparation and Protocol:

• Lysate preparation:

  • For tissue samples: Homogenize 50-100mg tissue in RIPA buffer containing protease inhibitors

  • For cell lines/primary cells: Lyse 1-5×10^6 cells in 100-200μl RIPA buffer

  • Include phosphatase inhibitors if examining phosphorylation states

  • Determine protein concentration using BCA or Bradford assay

• Gel electrophoresis:

  • Load 40μg of protein per lane (as shown in validated examples)

  • Use 10% SDS-PAGE gels for optimal separation of KLRB1 (40-44 kDa range)

  • Include molecular weight markers covering 25-75 kDa range

• Transfer and blocking:

  • Transfer to PVDF membrane (preferred over nitrocellulose for glycoproteins like KLRB1)

  • Block with 5% non-fat milk in TBS-T for 1 hour at room temperature

• Antibody incubation:

  • Primary antibody dilutions:

    • A37904: 1/300 dilution

    • WH0003820M1 (clone 2F3): 1-5 μg/mL

  • Incubate overnight at 4°C

  • Secondary antibody: HRP-conjugated anti-rabbit or anti-mouse IgG at 1:8000 dilution

  • Incubate for 1 hour at room temperature

• Detection and exposure:

  • Develop using ECL substrate

  • Optimal exposure time: Start with 1 minute (as shown in validation data) and adjust as needed

Technical Considerations:

• Expect KLRB1 to appear as bands between 40-44 kDa, potentially as a dimer under non-reducing conditions

• Positive controls should include NK cell lines or tissues with high NK content (e.g., human fetal liver as shown in validation data)

• Sample denaturation temperature can impact results; if not detecting KLRB1, try reducing boiling time or temperature

• For detection of glycosylated forms, enzymatic deglycosylation treatments may help identify core protein size

This protocol has been validated to detect endogenous KLRB1 in human and mouse samples, with demonstrated success using various antibodies specified in the search results .

How can I optimize immunohistochemistry protocols for KLRB1 detection in tissue sections?

Optimizing immunohistochemistry (IHC) for KLRB1 detection requires careful attention to tissue processing, antigen retrieval, and antibody titration. Follow this detailed methodology:

Tissue Preparation and Protocol:

• Fixation and processing:

  • For FFPE (formalin-fixed paraffin-embedded) sections: Fix tissues in 10% neutral buffered formalin for 24-48 hours at room temperature

  • Section at 4-5μm thickness and mount on positively charged slides

  • Deparaffinize in xylene and rehydrate through graded alcohols to water

• Antigen retrieval (critical for KLRB1 detection):

  • Heat-induced epitope retrieval (HIER) in citrate buffer (pH 6.0) for 20 minutes at 95-98°C

  • Allow sections to cool in buffer for 20 minutes, then rinse in PBS

• Endogenous peroxidase and blocking:

  • Quench endogenous peroxidase with 3% H₂O₂ in methanol for 10 minutes

  • Apply protein block (2-5% normal serum from same species as secondary antibody)

  • For tissues with high NK content, include avidin/biotin blocking if using biotin-based detection systems

• Primary antibody incubation:

  • Dilution ranges for KLRB1 antibodies:

    • HPA039113: 1:20-1:50 dilution (recommended for IHC)

    • A37904: Validated for IHC (consult specific product instructions)

  • Incubate overnight at 4°C in a humidified chamber

  • Include negative controls (isotype control or primary antibody omission)

  • Include positive controls (lymphoid tissue with known NK/NKT cell presence)

• Detection system:

  • Apply appropriate HRP-polymer or biotin-based detection system according to manufacturer's protocols

  • Develop with DAB (3,3'-diaminobenzidine) substrate for 5-10 minutes

  • Counterstain with hematoxylin, dehydrate, clear, and mount with permanent mounting medium

Optimization Strategies:

• Perform antibody titration experiments to determine optimal concentration for specific tissues

• If background is high, increase blocking time or concentration, or add 0.1-0.3% Triton X-100 to enhance antibody penetration

• For double immunostaining to identify KLRB1+ cell subsets, consider sequential staining protocols with appropriate lineage markers (CD3, CD4, CD8, CD56)

• For challenging tissues, consider tyramide signal amplification (TSA) to enhance detection sensitivity

This protocol has been validated for human tissues and provides specific cellular localization of KLRB1, which should appear as membrane staining primarily on lymphoid cells .

How should I interpret variations in KLRB1 expression levels across different immune cell populations?

Interpreting variations in KLRB1 expression requires understanding its normal distribution pattern and how it correlates with cellular function. Here's a methodological approach to data interpretation:

Normal Expression Pattern Reference Table:

Interpretation Framework:

• Baseline variation interpretation: When analyzing KLRB1 expression, compare your findings to the established patterns above. NK cells should serve as internal positive controls, while neutrophils and B cells typically lack expression and serve as negative controls.

• Methodological considerations for expression analysis:

  • For flow cytometry: Use median fluorescence intensity (MFI) to quantify expression levels and percentage of positive cells to determine population distribution

  • For IHC: Assess staining intensity (0-3+) and percentage of positive cells for semi-quantitative scoring

  • For Western blot: Normalize band intensity to appropriate loading controls and compare across samples

• Biological significance of expression patterns:

  • High KLRB1 expression on T cells often correlates with:

    • Tissue-homing capacity

    • IL-17 production potential

    • Memory phenotype

  • Decreased expression may indicate:

    • Functional exhaustion in chronic stimulation

    • Altered activation states

• Experimental factors affecting expression:

  • Cell activation status can modulate KLRB1 expression

  • Tissue source affects baseline expression (peripheral blood vs. tissue-resident populations)

  • Disease states may significantly alter normal expression patterns

What are common pitfalls in KLRB1 antibody experiments and how can they be avoided?

Successful KLRB1 antibody experiments require awareness of several technical challenges. Here's a comprehensive troubleshooting guide addressing common pitfalls across different applications:

Common Pitfalls and Methodological Solutions:

• False negatives in flow cytometry:

  • Pitfall: No staining despite expected KLRB1 expression

  • Solutions:

    • Confirm antibody clone reactivity with your species of interest

    • Verify that fixation/permeabilization hasn't altered the epitope

    • Test alternative clones (HP-3G10 has validated reactivity across human and non-human primates)

    • Include positive control samples (NK cell line or mixed lymphocyte preparation)

    • Check for fluorophore degradation (especially with tandem dyes like PerCP/Cy5.5)

• Non-specific binding in Western blot:

  • Pitfall: Multiple unexpected bands

  • Solutions:

    • Optimize antibody concentration (start with 1:300 dilution for A37904 or 1-5 μg/mL for clone 2F3)

    • Increase blocking stringency (5% BSA instead of milk for phospho-specific detection)

    • Include blocking peptide controls

    • Run reducing and non-reducing conditions in parallel (KLRB1 is a homodimer)

    • Extended blocking time (overnight at 4°C)

• Background staining in IHC:

  • Pitfall: Diffuse or non-specific tissue staining

  • Solutions:

    • Optimize antibody dilution (1:20-1:50 for HPA039113)

    • Increase blocking time and concentration

    • Add avidin/biotin blocking when using biotin-based detection

    • Consider autofluorescence quenching reagents if using fluorescence detection

    • Use more extensive washing steps (5×5 minutes)

• Epitope masking issues:

  • Pitfall: Loss of reactivity in fixed samples

  • Solutions:

    • Optimize antigen retrieval methods (compare citrate vs. EDTA buffers)

    • Reduce fixation time

    • Try alternative fixatives (paraformaldehyde vs. formalin)

    • Select antibodies recognizing different epitopes (extracellular vs. intracellular domains)

• Inconsistent results across experiments:

  • Pitfall: Variable staining intensity between experiments

  • Solutions:

    • Standardize cell isolation/processing times

    • Prepare master mixes of antibody dilutions

    • Include consistent positive and negative controls

    • Document lot numbers and storage conditions

    • Consider developing a reference standard (lyophilized cells with known KLRB1 expression)

By anticipating these challenges and implementing recommended solutions, researchers can significantly improve experimental reproducibility and data quality when working with KLRB1 antibodies .

How can KLRB1 antibodies be applied in single-cell analysis and multi-parametric studies?

KLRB1 antibodies are valuable tools in advanced single-cell and multi-parametric studies, enabling deeper insights into immune cell heterogeneity and function. Here's a methodological approach for incorporating KLRB1 antibodies in cutting-edge applications:

Single-Cell Analysis Applications:

• Mass cytometry (CyTOF) integration:

  • Methodology: Conjugate anti-KLRB1 antibodies (e.g., clone HP-3G10) with rare earth metals

  • Panel design considerations:

    • Include in NK/T cell-focused panels alongside markers like CD56, CD3, CD4, CD8, and functional markers

    • Optimal for 30+ parameter panels investigating rare subpopulations

    • Compatible with intracellular cytokine staining to correlate KLRB1 expression with IL-17, IFN-γ, or TNF-α production

• Single-cell RNA-seq validation:

  • Application: Use KLRB1 antibodies to validate protein expression in populations identified by scRNA-seq

  • Methodology:

    • CITE-seq (Cellular Indexing of Transcriptomes and Epitopes by Sequencing) using oligo-tagged KLRB1 antibodies

    • Flow sorting of KLRB1+ and KLRB1- populations for downstream transcriptomic analysis

    • Spatial transcriptomics combined with KLRB1 immunostaining for contextual information

Multi-parametric Study Designs:

• Comprehensive immune monitoring panels:

  • Design strategy: Include KLRB1 in panels targeting:

    • Innate lymphoid cell (ILC) diversity (alongside RORγt, T-bet, GATA3)

    • Th17/Tc17 identification (with CCR6, IL-23R, IL-17)

    • Tissue-resident memory T cells (with CD103, CD69, CD49a)

  • Technical approach: Use brightness-matched fluorophores to maintain sensitivity across all markers

• Functional correlation studies:

  • Methodology: Combine KLRB1 staining with:

    • Phospho-flow cytometry to examine signaling (pAKT, pERK) downstream of KLRB1 engagement

    • Degranulation assays (CD107a) to correlate KLRB1 expression with NK cytotoxic capacity

    • Cytokine production assays to link KLRB1 expression to functional outputs

• Imaging mass cytometry or multiplex immunofluorescence:

  • Application: Spatial distribution of KLRB1+ cells in tissues

  • Methodology:

    • Combine KLRB1 antibodies with tissue-specific markers and other immune markers

    • Use spectral unmixing for multiplex immunofluorescence with 6-8 markers

    • Apply computational spatial analysis to identify cellular neighborhoods and interactions

Data Analysis Considerations:

• Implement dimensionality reduction techniques (tSNE, UMAP) to visualize KLRB1+ populations in high-dimensional data

• Use clustering algorithms (FlowSOM, PhenoGraph) to identify novel KLRB1+ subpopulations

• Apply trajectory analysis to map developmental relationships of KLRB1+ cells

These advanced applications enable researchers to move beyond simple phenotyping to understand the functional significance of KLRB1 expression in complex immune responses .

What strategies can be used to investigate KLRB1-ligand interactions and downstream signaling pathways?

Investigating KLRB1-ligand interactions and downstream signaling requires sophisticated experimental approaches. Here's a comprehensive methodological framework:

Ligand Interaction Analysis:

• Binding assays to confirm CLEC2D/LLT1 interaction:

  • Protein-protein interaction methods:

    • ELISA-based binding assays using recombinant KLRB1 and CLEC2D proteins

    • Surface plasmon resonance (SPR) to determine binding kinetics and affinity

    • Bio-layer interferometry for real-time interaction analysis

  • Cellular binding assays:

    • Flow cytometry with fluorescently-labeled soluble KLRB1 to detect binding to CLEC2D-expressing cells

    • Cell-cell adhesion assays comparing KLRB1+ and KLRB1- effectors against CLEC2D+ targets

• Investigation of carbohydrate binding properties:

  • Methodology: Glycan array screening to identify specific carbohydrate structures recognized by KLRB1

  • Validation: Mutational analysis of the C-type lectin domain to map residues essential for Gal-alpha(1,3)Gal and N-acetyllactosamine binding

  • Functional relevance: Correlation of glycan binding with cellular responses

Signaling Pathway Investigation:

• Proximal signaling events after KLRB1 engagement:

  • Approaches to monitor SMPD1 activation:

    • Sphingomyelinase activity assays following antibody-mediated KLRB1 crosslinking

    • Live-cell imaging of ceramide production using fluorescent ceramide analogs

  • Analysis of protein phosphorylation:

    • Immunoprecipitation of KLRB1 followed by phospho-tyrosine immunoblotting

    • Phospho-specific antibodies to detect activation of AKT1/PKB and RPS6KA1/RSK1

    • Phospho-flow cytometry to monitor signaling at single-cell resolution

• Downstream pathway analysis:

  • Transcriptional response profiling:

    • RNA-seq of cells before and after KLRB1 engagement to identify regulated genes

    • ChIP-seq to map transcription factor binding affected by KLRB1 signaling

  • Functional outcome assessment:

    • Cytokine secretion (ELISA, cytometric bead array) following KLRB1 activation

    • Cytotoxicity assays to quantify inhibition of NK cell killing

Advanced Methodological Approaches:

• CRISPR-based genetic manipulation:

  • Generate KLRB1 knockout cell lines to confirm signaling specificity

  • Create domain-specific mutations to map structure-function relationships

  • Introduce tagged KLRB1 constructs for live-cell imaging and interactome studies

• Proximity labeling techniques:

  • BioID or APEX2 fusion to KLRB1 to identify proximal proteins in the signaling complex

  • Validation of novel interaction partners by co-immunoprecipitation and functional assays

• Single-molecule imaging:

  • TIRF microscopy to visualize KLRB1 clustering upon ligand engagement

  • FRET-based sensors to detect conformational changes and protein-protein interactions

By systematically applying these methodologies, researchers can build a comprehensive understanding of KLRB1 biology, from initial ligand recognition to resultant cellular responses, providing insights into its role in immune regulation .

How can researchers effectively use KLRB1 antibodies in studying disease models and clinical samples?

KLRB1 antibodies offer valuable insights in disease research and clinical sample analysis. Here's a methodological framework for their effective application across different pathological contexts:

Autoimmune Disease Models and Samples:

• Multiple sclerosis/EAE model applications:

  • Methodology:

    • Flow cytometric analysis of CNS-infiltrating lymphocytes using anti-KLRB1 antibodies (e.g., HP-3G10)

    • Multiplex IHC of brain lesions to characterize KLRB1+ cells in inflammatory foci

  • Research questions:

    • Do KLRB1+CCR6+ Th17 cells preferentially infiltrate the CNS?

    • Can KLRB1 expression predict disease progression or treatment response?

    • Does targeting KLRB1+ cells affect disease severity?

• Rheumatoid arthritis research:

  • Sample types: Synovial fluid, synovial tissue biopsies

  • Technical approach:

    • Paired analysis of blood and synovial fluid to assess KLRB1+ cell enrichment

    • Single-cell analysis to identify disease-specific KLRB1+ subpopulations

    • Correlation of KLRB1 expression with clinical disease activity scores

Cancer Immunology Applications:

• Tumor-infiltrating lymphocyte (TIL) analysis:

  • Protocol optimization:

    • Gentle tissue dissociation to preserve KLRB1 surface expression

    • Panel design incorporating KLRB1 with exhaustion markers (PD-1, TIM-3, LAG-3)

    • Spatial analysis of KLRB1+ cells relative to tumor cells using multiplexed IHC

  • Clinical correlations:

    • Association of KLRB1+ NK/T cell infiltration with patient outcomes

    • Changes in KLRB1 expression during immunotherapy

    • Potential use as a biomarker for immunotherapy response

• Hematological malignancies:

  • Application: Distinguishing normal vs. neoplastic NK cells

  • Methodology:

    • Flow cytometric analysis of bone marrow and peripheral blood

    • Integration with other NK cell markers (CD56, CD16, CD94/NKG2A)

    • Tracking KLRB1 expression during disease progression and treatment

Infectious Disease Research:

• Viral hepatitis studies:

  • Liver biopsy analysis:

    • IHC detection of KLRB1+ cells in portal and lobular inflammation

    • Correlation with viral load and disease progression

  • Functional studies:

    • Ex vivo stimulation of KLRB1+ cells from infected individuals

    • Assessment of antiviral cytokine production capacity

• HIV infection:

  • Application: Monitoring KLRB1+ T cell subsets during disease progression

  • Methodology:

    • Longitudinal analysis of KLRB1 expression on CD4+ and CD8+ T cells

    • Correlation with viral load, CD4 count, and immune activation markers

    • Assessment of KLRB1+ cell reconstitution during antiretroviral therapy

Methodological Considerations for Clinical Translation:

• Standardization for clinical applications:

  • Establish reference ranges for KLRB1 expression in healthy controls

  • Develop standardized staining and analysis protocols for clinical laboratories

  • Create stabilized control samples for inter-laboratory validation

• Biobanking optimization:

  • Validate antibody performance on cryopreserved samples

  • Determine optimal fixation protocols that preserve KLRB1 epitopes

  • Test antibody stability on long-term stored FFPE tissues

• High-dimensional analysis of clinical cohorts:

  • Integrate KLRB1 in CyTOF or spectral flow cytometry panels

  • Apply machine learning algorithms to identify disease-specific KLRB1+ populations

  • Develop composite biomarkers incorporating KLRB1 with other immune parameters

These methodological approaches provide a framework for translating KLRB1 antibody use from basic research to clinically relevant applications, potentially yielding new diagnostic, prognostic, or therapeutic insights across multiple disease contexts .

What are the most promising future directions for KLRB1 antibody applications in immunological research?

The field of KLRB1 antibody applications is evolving rapidly, with several promising research directions emerging. Based on current knowledge and technological advancements, researchers should consider these methodological approaches for future investigations:

• Advanced imaging technologies:

  • Super-resolution microscopy: Apply techniques like STORM or PALM using KLRB1 antibodies to visualize receptor clustering and membrane organization at nanometer resolution.

  • Intravital imaging: Develop non-disruptive labeling strategies using fluorescently-tagged Fab fragments of KLRB1 antibodies to track KLRB1+ cells in living tissues.

  • 4D analysis: Combine spatial and temporal dimensions to understand KLRB1+ cell trafficking and interactions in real-time during immune responses.

• Therapeutic targeting approaches:

  • KLRB1-directed CAR-T cells: Engineer T cells with chimeric antigen receptors incorporating anti-KLRB1 scFv domains to target malignancies with aberrant KLRB1 expression.

  • Bispecific antibodies: Develop constructs linking KLRB1 recognition with CD3 engagement to redirect T cells against KLRB1-expressing targets.

  • Immune checkpoint modulation: Investigate the potential of KLRB1-CLEC2D blockade as a novel immune checkpoint strategy for cancer immunotherapy.

• System-level analysis:

  • Multi-omics integration: Combine KLRB1 antibody-based proteomics with transcriptomics, metabolomics, and epigenomics to build comprehensive models of KLRB1+ cell states.

  • Artificial intelligence applications: Apply machine learning to identify novel KLRB1+ cell subsets and their functional correlates across diseases.

  • Network modeling: Map KLRB1-dependent signaling networks and their intersections with other immune regulatory pathways.

• Clinical translation opportunities:

  • Companion diagnostics: Develop standardized KLRB1 antibody-based assays to guide patient selection for targeted therapies.

  • Monitoring immune reconstitution: Track KLRB1+ cell recovery after hematopoietic stem cell transplantation or immunosuppressive therapy.

  • Predictive biomarkers: Validate KLRB1 expression profiles as indicators of treatment response in autoimmunity and cancer.

• Technical innovations:

  • Antibody engineering: Create recombinant antibody formats with enhanced tissue penetration or reduced immunogenicity for in vivo applications.

  • Conditional detection systems: Develop antibody-based sensors that report KLRB1 engagement through fluorescence or bioluminescence signals.

  • Single-domain antibodies: Explore nanobodies or single-chain variable fragments against KLRB1 for applications requiring smaller recognition molecules.

By pursuing these directions, researchers can leverage KLRB1 antibodies beyond conventional applications to address fundamental questions about immune regulation and develop novel diagnostic or therapeutic strategies for immune-mediated diseases .

How can researchers validate new findings related to KLRB1 expression and function?

Rigorous validation of KLRB1-related findings requires a multi-faceted approach combining complementary techniques and appropriate controls. Below is a comprehensive methodological framework for robust validation:

Multi-technique Validation Strategy:

• Cross-platform verification:

  • Primary validation: Confirm key findings using at least two independent techniques:

    • Flow cytometry + western blot

    • RNA-seq + protein-level detection

    • IHC + in situ hybridization

  • Methodological rationale: Different techniques have distinct biases and limitations; concordance across platforms strengthens confidence in results.

• Antibody validation requirements:

  • Specificity controls:

    • Test antibodies on KLRB1 knockout or knockdown samples

    • Compare staining patterns across multiple antibody clones recognizing different epitopes

    • Include blocking peptide controls

  • Technical controls:

    • Use isotype controls matched to primary antibody concentration

    • Include positive control samples with known KLRB1 expression

    • Perform titration experiments to establish optimal antibody concentration

• Functional validation approaches:

  • Cellular manipulation:

    • Genetic modification (CRISPR/Cas9 editing of KLRB1)

    • Antibody-mediated blockade of KLRB1-CLEC2D interaction

    • Overexpression studies with wild-type and mutant KLRB1 constructs

  • Functional readouts:

    • Cytotoxicity assays for NK cell functions

    • Proliferation and cytokine production for T cell populations

    • Migration assays for tissue homing capacity

Experimental Design Considerations:

• Statistical rigor:

  • Determine appropriate sample sizes through power calculations

  • Use matched controls whenever possible

  • Apply appropriate statistical tests with correction for multiple comparisons

  • Report effect sizes alongside p-values

• Reproducibility practices:

  • Document detailed protocols including antibody catalog numbers, clones, and dilutions

  • Maintain consistent gating strategies or analysis parameters across experiments

  • Repeat key experiments with independent biological samples

  • Consider blinded analysis for subjective assessments (e.g., IHC scoring)

• Translational validation:

  • Confirm findings across species when possible (human and mouse models)

  • Verify observations in multiple cell types or tissues

  • Validate in vitro findings in relevant in vivo models

  • Test observations in clinical samples from diverse patient populations

Advanced Validation Approaches:

• Single-cell resolution validation:

  • Correlate KLRB1 protein expression with mRNA at single-cell level

  • Map spatial distribution of KLRB1+ cells relative to their interaction partners

  • Track temporal changes in KLRB1 expression during immune responses

• Systems biology integration:

  • Correlate KLRB1 findings with broader immune network behaviors

  • Develop predictive models and test hypotheses in independent datasets

  • Position KLRB1-related observations within established immunological paradigms