litaf Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to LITAF Antibody

The LITAF antibody is a research reagent designed to detect Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF), a transcription factor critical in immune regulation and inflammation. LITAF, initially identified for its role in TNF-α expression, facilitates the transcription of pro-inflammatory cytokines (e.g., IL-1α, TNF-α, MCP-2) and interacts with pathways involving STAT6 and p38 MAPK . Its dysfunction is linked to Charcot-Marie-Tooth neuropathy type 1C (CMT1C) and immune-related cancers .

Structure and Function of LITAF

LITAF is a 28 kDa protein localized to lysosomal/late endosomal membranes . It contains a conserved ubiquitin-interacting motif (UIM) that mediates protein degradation and interacts with ubiquitin ligases . LITAF also regulates autophagy in B-cell lymphomas via a feedback loop with BCL6, acting as a tumor suppressor .

DomainFunctionReferences
UIMUbiquitin binding, protein degradation
Transcription factor domainRegulates cytokine transcription

Applications of LITAF Antibody

The antibody is used in diverse assays to study LITAF expression and localization:

3.1. Western Blot (WB)

  • Detects LITAF in lysates of cancer cell lines (A431, HeLa, HepG2) .

  • Confirms LITAF expression in immune tissues (spleen, intestine) .

3.2. Immunohistochemistry (IHC)

  • Localizes LITAF to lymphocytes in intestinal villi and lysosomal compartments .

3.3. Immunocytochemistry (ICC)

  • Visualizes LITAF on cell surfaces of A431 carcinoma cells .

5.1. Immune Regulation

  • LITAF-deficient mice exhibit reduced cytokine responses (IL-6, TNF-α) to LPS, highlighting its role in endotoxic shock .

  • LITAF interacts with TLR4 in chicken immune cells, modulating microbial resistance .

5.2. Cancer and Disease

  • LITAF is methylated in 89.5% of B-cell non-Hodgkin lymphoma (B-NHL) cases, correlating with oncogenesis .

  • Mutations in LITAF cause demyelinating neuropathy (CMT1C) .

5.3. Therapeutic Implications

  • Targeting LITAF pathways may reduce inflammation in chronic diseases (e.g., arthritis) .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
litaf antibody; zgc:91882 antibody; Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog antibody; LPS-induced TNF-alpha factor homolog antibody
Target Names
litaf
Uniprot No.

Target Background

Function
Litaf antibody plays a crucial role in endosomal protein trafficking and targets proteins for lysosomal degradation. It may also contribute to the regulation of gene expression within the nucleus. In vitro studies have shown that Litaf antibody binds to DNA, suggesting a potential synergistic role in regulating the expression of numerous cytokines in the nucleus.
Database Links
Protein Families
CDIP1/LITAF family
Subcellular Location
Cytoplasm. Nucleus. Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Early endosome membrane. Late endosome membrane. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Golgi apparatus membrane.

Q&A

What is LITAF and what is its biological significance?

LITAF is a 161 amino acid cellular protein that functions as a transcription factor involved in immune responses and inflammation. The protein contains a proline-rich N-terminus and a conserved C-terminal domain known as the simple-like domain (SLD) . LITAF plays a key role in regulating inflammatory responses and immune activation, making it a significant target for research in various disease contexts including cancer, infectious diseases, and autoimmune disorders . The protein's involvement in immune signaling pathways positions it as an important molecule for therapeutic development.

What are the structural characteristics of the LITAF protein?

LITAF consists of 161 amino acids with a distinctive structure that includes:

  • A proline-rich N-terminus that facilitates protein-protein interactions

  • A conserved C-terminal domain called the simple-like domain (SLD)

  • The SLD contains a RING finger domain interrupted by hydrophobic amino acids

The full sequence is: MSVPGPYQAATGPSSAPSAPPSYEETVANVSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL .

How do different LITAF antibody types compare in terms of applications?

Different LITAF antibodies are optimized for specific applications based on their characteristics:

Antibody IDHostClonalityApplicationsReactivity
ABIN6262981RabbitPolyclonalWB, IHC, ELISAHuman, Mouse, Rat
ABIN238579GoatPolyclonalIHC, ELISAHuman
CAB5469RabbitPolyclonalWB, IHC-P, IP, ELISAHuman, Mouse

For Western blotting applications, rabbit polyclonal antibodies like ABIN6262981 and CAB5469 are commonly used . When cross-species reactivity is essential, selecting antibodies like ABIN6262981 that react with human, mouse, and rat samples is advantageous . For immunohistochemistry on paraffin-embedded tissues, CAB5469 with its validated IHC-P application would be more suitable .

What are the optimal dilutions and conditions for LITAF antibody applications?

The recommended dilutions vary by application and specific antibody:

  • Western Blotting: For CAB5469, the optimal dilution ranges from 1:500 to 1:2000 . When using ABIN6262981, similar ranges are generally appropriate for detecting endogenous levels of LITAF .

  • Immunohistochemistry: For IHC-P using CAB5469, dilutions of 1:50 to 1:200 are recommended . ABIN238579, a goat polyclonal antibody, is specifically optimized for IHC applications .

  • Immunoprecipitation: When performing IP with CAB5469, 0.5μg-4μg of antibody is recommended for 200μg-400μg of whole cell extracts .

  • ELISA: All three antibodies (ABIN6262981, ABIN238579, and CAB5469) are suitable for ELISA applications, though specific dilution recommendations should be optimized for each experimental setup .

How can I validate the specificity of my LITAF antibody?

Validating antibody specificity is crucial for reliable research outcomes. Several approaches are recommended:

  • Knockout validation: The CAB5469 antibody is described as "KO Validated," indicating it has been tested in knockout systems where LITAF is not expressed, confirming specificity .

  • Western blot analysis: Verify the detection of a band at the expected molecular weight (calculated MW is 17kDa, though observed MW is typically 23kDa due to post-translational modifications) .

  • Positive control samples: Use validated positive samples like HeLa cells, which are known to express LITAF .

  • Peptide competition assays: Preincubate the antibody with the immunizing peptide to demonstrate signal reduction.

  • Multiple antibody comparison: Compare results from antibodies targeting different regions of LITAF (e.g., internal region versus N-terminal epitopes) .

What controls should be included when using LITAF antibodies?

Proper experimental controls are essential for meaningful data interpretation:

  • Positive tissue/cell controls: Include samples known to express LITAF, such as HeLa cells .

  • Negative controls: Use samples where LITAF expression is absent or significantly reduced.

  • Isotype controls: Include the appropriate IgG isotype control (from the same host species) to account for non-specific binding.

  • Loading controls: For Western blotting, include housekeeping proteins (e.g., β-actin, GAPDH) to normalize protein loading.

  • Secondary antibody-only control: Omit the primary antibody to assess non-specific binding of the secondary antibody.

How does the simple-like domain (SLD) influence LITAF trafficking and function?

The SLD plays a crucial role in LITAF's cellular localization and function:

  • Aggresome targeting: Research shows that the SLD alone is sufficient to target LITAF to aggresomes, specialized structures that sequester misfolded proteins .

  • Temporal dynamics: When expressed alone, the SLD shows distinct temporal dynamics compared to full-length LITAF:

    • At 24 hours post-transfection, both full-length LITAF and SLD show punctate cytoplasmic staining with high co-localization

    • By 36 hours, SLD redistributes to a more concentrated perinuclear location

    • At 48 hours, SLD continues to concentrate in the perinuclear region while maintaining some overlap with full-length LITAF

  • Membrane association: The SLD contains a RING finger domain interrupted by hydrophobic amino acids, which likely mediates the protein's association with cellular membranes .

This differential localization suggests the SLD domain may have independent functions from the full-length protein, potentially in protein quality control or stress responses.

What techniques can be combined with LITAF immunodetection for comprehensive functional studies?

Several complementary techniques can enhance LITAF research:

  • Co-immunoprecipitation with LITAF antibodies: To identify protein interaction partners in different cellular contexts.

  • Immunofluorescence microscopy: Combining LITAF antibodies with markers for cellular compartments (lysosomes, endosomes, aggresomes) can reveal dynamic localization patterns. This approach revealed that the SLD domain shows different localization patterns compared to full-length LITAF over time .

  • ChIP-seq: Some LITAF antibodies are validated for ChIP-seq applications, allowing researchers to identify DNA binding sites of LITAF in its role as a transcription factor .

  • Transfection studies: Expressing tagged versions of LITAF (e.g., FLAG-tagged LITAF or Myc-tagged SLD domain) alongside immunodetection of endogenous LITAF can reveal functional differences between domains .

  • Subcellular fractionation: Combined with Western blotting using LITAF antibodies to track protein distribution within cellular compartments.

How can LITAF antibodies be used to study aggresomes and protein quality control?

LITAF's association with aggresomes makes it a valuable target for studying protein quality control mechanisms:

  • Monitoring aggresome formation: LITAF antibodies can be used to track the formation and dynamics of aggresomes in response to cellular stress.

  • Domain-specific functions: By comparing full-length LITAF with the SLD domain alone, researchers have determined that the SLD is sufficient for targeting to aggresomes, indicating its role in protein quality control .

  • Co-localization studies: LITAF antibodies can be used alongside markers for aggresomes (e.g., vimentin, ubiquitin) to study the temporal dynamics of aggresome formation.

  • Stress response analysis: Tracking LITAF localization using specific antibodies during various cellular stresses can reveal mechanisms of protein quality control.

The targeting of endogenous LITAF to aggresomes suggests its involvement in cellular stress responses, making LITAF antibodies valuable tools for studying proteostasis and quality control mechanisms.

Why might I observe multiple bands when performing Western blot with LITAF antibodies?

Multiple bands in LITAF Western blots can occur for several reasons:

  • Isoform detection: LITAF has reported isoforms (NP_004853.2, NP_001129945.1), and some antibodies like ABIN238579 are expected to cross-react with both .

  • Molecular weight discrepancies: While the calculated molecular weight of LITAF is 17kDa, the observed molecular weight is typically 23kDa . This discrepancy is likely due to post-translational modifications.

  • Proteolytic degradation: Incomplete protease inhibition during sample preparation may result in degradation products appearing as lower molecular weight bands.

  • Post-translational modifications: Different phosphorylation, ubiquitination, or other modifications may result in band shifts.

  • Cross-reactivity: Despite purification efforts, some antibodies may exhibit limited cross-reactivity with structurally similar proteins.

To address this issue, compare results with multiple LITAF antibodies targeting different epitopes and include appropriate positive controls.

How can I address weak or inconsistent signals when using LITAF antibodies?

When facing weak or inconsistent signals, consider these approaches:

  • Antibody dilution optimization: Test a range of dilutions around the recommended values (e.g., for CAB5469, try 1:250 to 1:2500 for Western blot) .

  • Sample preparation improvements:

    • Ensure complete lysis with appropriate buffers

    • Include protease and phosphatase inhibitors

    • Avoid repeated freeze-thaw cycles of samples

  • Increased protein loading: For Western blots, consider loading more total protein if expression levels are low.

  • Signal enhancement techniques:

    • Use more sensitive detection substrates

    • Increase antibody incubation time (e.g., overnight at 4°C)

    • Employ signal amplification systems for IHC applications

  • Antibody selection: Different antibodies target different epitopes with varying accessibility. The epitope recognized by ABIN238579 (sequence PDGKGMNPPSYYTQ) is in the internal region , while other antibodies may target different regions.

What factors might contribute to non-specific binding of LITAF antibodies?

Non-specific binding can compromise research results. Several factors may contribute:

  • Insufficient blocking: Optimize blocking conditions (concentration, time, temperature) to reduce background.

  • Suboptimal washing: Increase washing steps duration or number to remove weakly bound antibodies.

  • Cross-reactivity: Despite purification by affinity chromatography , some antibodies may bind to proteins with similar epitopes.

  • Sample complexity: High complexity samples may benefit from additional purification steps before antibody application.

  • Antibody quality: Ensure antibodies are stored properly and not used beyond their shelf life.

To address these issues, include appropriate negative controls and consider testing multiple LITAF antibodies raised against different epitopes.

How can I effectively study LITAF subcellular localization?

LITAF exhibits dynamic subcellular localization that can be studied using these approaches:

  • Co-localization immunofluorescence: Combining LITAF antibodies with markers for:

    • Lysosomes (LITAF has been reported at lysosomal membranes)

    • Late endosomes

    • Aggresomes (the SLD domain targets LITAF to these structures)

  • Cellular fractionation: Separate cellular compartments biochemically and detect LITAF in different fractions using Western blotting.

  • Temporal analysis: As demonstrated with the SLD domain, LITAF localization can change over time (24, 36, and 48 hours post-transfection showed different localization patterns) .

  • Expression constructs: Utilizing FLAG-tagged full-length LITAF and Myc-tagged SLD domain constructs can help distinguish transfected from endogenous protein and allow comparison of localization patterns .

  • Stress conditions: Examining LITAF localization under various cellular stresses may reveal dynamic trafficking patterns related to its function.

Understanding LITAF's localization is crucial as it has been reported at the "cytoplasmic side, lysosome membrane, peripheral membrane protein" , suggesting important functional implications.

What protocols are recommended for cloning and expressing LITAF for antibody validation?

Based on published methodologies, the following protocol can be adapted for LITAF cloning and expression:

  • PCR amplification of LITAF:

    • Use PCR buffer (1X), MgCl₂ (3.0 mM), Taq DNA polymerase (2.5 U)

    • Forward primer: 5′-AAGCTTATGGATTACAAGGATGACGACGATAAGTCGGTTCCAGGACCTTACC-3′

    • Reverse primer: 5′-CTCGAGCTAAAAGCGTTGTAGGTG-3′

    • Cycling conditions: 94°C (30 sec), 52°C (30 sec), 72°C (90 sec) for 30 cycles

  • Cloning strategy:

    • Initial cloning into pGEM-T easy vector

    • Subsequent subcloning into pcDNA3.1 using XhoI and HindIII sites

  • Expression systems:

    • Transfection into mammalian cells (BGMK cells have been used successfully)

    • Allow 24-48 hours for expression before analysis

  • Detection methods:

    • For FLAG-tagged constructs, anti-FLAG antibodies can detect transfected protein

    • For Myc-tagged constructs, anti-Myc antibodies can be used

    • Compare with endogenous LITAF detection using specific antibodies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.