mid1ip1b Antibody

Shipped with Ice Packs
In Stock

Description

Overview of MID1IP1 Antibody

MID1IP1 antibodies target a 183-amino-acid protein involved in lipid metabolism and cancer progression. These antibodies are primarily used to study MID1IP1's roles in:

  • Regulation of lipogenesis and lipid biosynthesis

  • Stabilization of microtubules and spindle assembly

  • Oncogenic signaling via c-Myc and p53 pathways

Key structural features:

  • Molecular Weight: Predicted 20 kDa (observed 23–46 kDa due to post-translational modifications)

  • Domains: SPOT14 family member with homodimerization capabilities

Notes:

  • Western Blot (WB): 15764-1-AP detects MID1IP1 at 23 kDa in HEK-293 cells .

  • Immunohistochemistry (IHC): HPA038816 validates MID1IP1 expression in human HCC tissues .

  • Cross-Reactivity: 15764-1-AP works across human, mouse, and rat samples, while others are human-specific .

Role in Cancer Apoptosis

  • CNOT2-MID1IP1-p53 Axis:
    MID1IP1 depletion induces apoptosis in colorectal cancer cells by stabilizing p53. CNOT2 inhibition enhances this effect, confirmed using 15764-1-AP in Western blotting .

    • Key Proteins: Cleaved PARP, p21, c-Myc

    • Mechanism: MID1IP1 interacts with ribosomal proteins L5/L11 to regulate c-Myc stability .

Lipid Metabolism Regulation

  • MID1IP1 upregulates acetyl-CoA carboxylase (ACACA), critical for lipid synthesis .

  • Antibodies like PA5-19370 are used to study MID1IP1’s role in triacylglycerol and phospholipid biosynthesis .

Colocalization with c-Myc in Liver Cancer

  • Tissue Array Data: MID1IP1 and c-Myc colocalize in hepatocellular carcinoma (HCC) tissues (IHC validated with ab224550 and ab32072) .

  • Functional Impact: MID1IP1 overexpression reduces p21 and activates c-Myc, promoting tumor growth .

Table 2: Recommended Dilutions

ApplicationDilution RangeAntibody Used
Western Blot1:200–1:100015764-1-AP, SAB1409589
Immunofluorescence1:100–1:500PA5-80815, ab97806
IHC1:50–1:200HPA038816

Key Research Insights

  • Therapeutic Potential: MID1IP1 depletion synergizes with chemotherapeutic agents (e.g., doxorubicin) to enhance apoptosis .

  • Biomarker Potential: Overexpression correlates with poor prognosis in HCC and colorectal cancer .

Limitations and Gaps

  • Isoform Specificity: No commercial antibodies target distinct MID1IP1 isoforms (e.g., "b" variants).

  • Species Limitations: Most antibodies lack cross-reactivity beyond human/mouse/rat .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
mid1ip1b antibody; si:dkey-277i15.1 antibody; zgc:73223Mid1-interacting protein 1-B antibody
Target Names
mid1ip1b
Uniprot No.

Target Background

Function
Mid1ip1b antibody is involved in the stabilization of microtubules. It may also play a role in the regulation of lipogenesis.
Database Links
Protein Families
SPOT14 family
Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, cytoskeleton.

Q&A

What is MID1IP1 and why is it important in research?

MID1IP1 (also known as MIG12, Spot 14-related protein, or S14R) is a ~20 kDa protein involved in multiple cellular processes. It plays a critical role in lipogenesis in the liver by up-regulating ACACA enzyme activity and is required for efficient biosynthesis of triacylglycerol, diacylglycerol, and phospholipids. Additionally, MID1IP1 interacts with MID1 protein to maintain microtubule network stability, which is essential for proper spindle assembly during cell division .

Recent research has identified MID1IP1 as a promising biomarker in lung cancer screening protocols, highlighting its clinical significance beyond basic cellular functions .

What types of MID1IP1 antibodies are currently available for research?

Several commercial MID1IP1 antibodies are available, with varying properties and applications:

Antibody TypeHostApplicationsReactivityImmunogen RegionReference
PolyclonalRabbitWBHuman, Mouse, RatSynthetic peptide from human MID1IP1
PolyclonalRabbitWBHumanaa 1 to C-terminus
PolyclonalRabbitIHC-PHumanRecombinant protein (aa 50-150)
PolyclonalRabbitIHC, IHC-PHumanRecombinant protein containing sequence CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA

Most available antibodies are rabbit polyclonals, optimized for specific applications like Western blotting (WB) or immunohistochemistry (IHC) .

How should I optimize Western blot protocols for MID1IP1 detection?

For optimal Western blot detection of MID1IP1:

  • Sample preparation: Use whole cell lysates from appropriate cell lines (e.g., HepG2 or 293T cells show good expression)

  • Gel selection: Use 12% SDS-PAGE for optimal separation around the 20 kDa range

  • Antibody dilution: Start with 1:1000 dilution for primary antibody incubation

  • Expected molecular weight: Look for a band at approximately 20 kDa

  • Controls: Include positive control lysates from cell lines known to express MID1IP1 (HepG2 is recommended)

  • Secondary antibody: Use appropriate anti-rabbit IgG conjugates (HRP, AP, or fluorescent labels)

These recommendations are based on validated protocols for MID1IP1 antibodies with successful detection in human samples .

What considerations should I make when using MID1IP1 antibodies for immunohistochemistry?

For immunohistochemistry applications with MID1IP1 antibodies:

  • Fixation: Standard formalin fixation and paraffin embedding is compatible

  • Antigen retrieval: Heat-induced epitope retrieval is recommended

  • Antibody dilution: Start with 1:50-1:200 dilution range

  • Incubation conditions: Overnight incubation at 4°C typically yields optimal results

  • Detection system: Both chromogenic and fluorescent detection systems are compatible

  • Controls: Include tissue samples known to express MID1IP1 (liver tissue is recommended)

These protocols have been validated for detecting endogenous MID1IP1 in human tissue samples .

How can I confirm the specificity of my MID1IP1 antibody?

To validate MID1IP1 antibody specificity:

  • Western blot analysis:

    • Compare band patterns in positive control tissues/cells

    • Verify the correct molecular weight (~20 kDa)

    • Perform knockdown experiments (siRNA or CRISPR) to confirm band disappearance

  • Immunoprecipitation validation:

    • Immunoprecipitate with the antibody and confirm identity by mass spectrometry

    • Co-IP experiments to verify interaction with known binding partners (e.g., MID1)

  • Commercial validation data:

    • Review vendor-provided validation data including specificity verification on protein arrays containing MID1IP1 alongside 383 non-specific proteins

    • Examine purification methods (antibodies purified by affinity-chromatography typically show >95% purity by SDS-PAGE)

What controls should I include when working with MID1IP1 antibodies?

Proper controls for MID1IP1 antibody experiments:

  • Positive controls:

    • Cell lines with confirmed expression (HepG2, 293T)

    • Tissue types known to express MID1IP1 (liver)

  • Negative controls:

    • Primary antibody omission

    • Isotype control antibody

    • Pre-adsorption with immunizing peptide

    • Tissues/cells with confirmed low or no expression

  • Method-specific controls:

    • For WB: Molecular weight markers to confirm band size

    • For IHC: Tissue panels with varying expression levels

Including these controls helps distinguish specific signal from background or non-specific binding .

How can MID1IP1 antibodies be used to study microtubule dynamics?

MID1IP1 interacts with MID1 to maintain microtubule network stability. To study this role:

  • Co-localization studies:

    • Combine MID1IP1 antibodies with microtubule markers (e.g., α-tubulin)

    • Use confocal microscopy to visualize co-localization patterns

  • Cell division analysis:

    • Examine MID1IP1 distribution during different cell cycle phases

    • Correlate with spindle assembly markers

  • Perturbation experiments:

    • Manipulate MID1IP1 levels and observe effects on microtubule stability

    • Combine with live cell imaging to track dynamics

This approach can reveal how MID1IP1 contributes to microtubule function and cell division processes, particularly spindle assembly during mitosis .

What is the role of MID1IP1 as a biomarker in cancer research?

Recent studies have identified MID1IP1 as a promising biomarker for lung cancer screening:

  • Performance metrics:

    • MID1IP1 showed an AUC of 0.72 in discriminating between actionable and non-actionable lung nodules

    • 82% accuracy in classifying histologically benign cases

  • Multimarker panels:

    • MID1IP1 performed optimally as part of a six-biomarker panel including Annexin 2, DCD, PNMA1, TAF10, and ZNF696

    • This panel achieved 72.48% accuracy with 76.62% sensitivity and 68.06% specificity for lung cancer screening

  • Comparative advantage:

    • While MID1IP1 had the highest AUC among tested biomarkers, others like MED21 showed higher sensitivity (79-83%)

These findings suggest MID1IP1 antibodies can be valuable tools in developing early detection methods for lung cancer .

How can MID1IP1 antibodies be integrated into lipid metabolism research?

To study MID1IP1's role in lipid metabolism:

  • Tissue-specific expression analysis:

    • Compare MID1IP1 levels across tissues with varying lipogenic activity

    • Correlate with nutritional status or metabolic disease models

  • Co-immunoprecipitation studies:

    • Use MID1IP1 antibodies to pull down protein complexes

    • Identify associations with lipogenic enzymes like ACACA

  • Functional assays:

    • Combine antibody detection with lipid quantification methods

    • Monitor MID1IP1 levels during lipogenic stimulation or inhibition

  • Subcellular localization:

    • Determine compartmentalization of MID1IP1 during active lipogenesis

    • Examine co-localization with lipid droplets or ER

This integrated approach can reveal how MID1IP1 regulates lipid biosynthetic pathways in normal physiology and disease states .

What are the common pitfalls when working with MID1IP1 antibodies?

Researchers frequently encounter these challenges with MID1IP1 antibodies:

  • Cross-reactivity issues:

    • Some antibodies may detect related proteins with similar epitopes

    • Validate specificity in your specific experimental system

  • Protein degradation:

    • The small size (~20 kDa) makes MID1IP1 susceptible to degradation

    • Use fresh samples and appropriate protease inhibitors

  • Low endogenous expression:

    • Expression levels vary significantly between tissues/cell types

    • May require signal amplification or more sensitive detection methods

  • Nonspecific background in IHC:

    • Optimize blocking conditions (5% BSA or normal serum)

    • Consider alternative fixation methods if background persists

How do I choose between different commercial MID1IP1 antibodies?

Selection criteria for MID1IP1 antibodies should include:

  • Application compatibility:

    • Match antibody specifications to your intended application (WB, IHC, etc.)

    • Review validation data for your specific application

  • Epitope location:

    • Consider epitope location relative to functional domains or post-translational modification sites

    • Different antibodies target different regions (N-terminal, C-terminal, or internal epitopes)

  • Species reactivity:

    • Verify cross-reactivity with your experimental species

    • Most antibodies react with human MID1IP1; some cross-react with mouse and rat

  • Validation robustness:

    • Evaluate the extent of validation (protein arrays, knockout validation, etc.)

    • Consider publications citing specific antibody catalog numbers

This systematic approach will help select the most appropriate antibody for your specific research needs .

How are MID1IP1 antibodies being used in novel research areas?

Beyond traditional applications, MID1IP1 antibodies are enabling research in:

  • Cancer biomarker development:

    • Integration into multi-biomarker screening panels for early cancer detection

    • Potential for liquid biopsy applications via autoantibody detection

  • Drug discovery:

    • Target validation for compounds affecting lipid metabolism

    • Monitoring molecular responses to therapeutic interventions

  • Cellular stress responses:

    • Investigating MID1IP1's role in metabolic adaptation to stress

    • Connections between microtubule function and metabolic regulation

These emerging applications demonstrate the versatility of MID1IP1 antibodies beyond traditional cell biology applications .

What are the latest methodological advances in antibody-based MID1IP1 research?

Recent methodological improvements include:

  • Computational antibody design:

    • Improved antibody design through computational modeling of epitope-paratope interactions

    • Machine learning approaches to predict antibody specificity and cross-reactivity

  • Multiplexed detection systems:

    • Integration of MID1IP1 detection into multiplexed immunoassays

    • Simultaneous analysis of multiple markers in single samples

  • Single-cell applications:

    • Adaptation of antibodies for single-cell protein analysis

    • Combined RNA-protein detection methods for correlation studies

These advances are expanding the utility and precision of MID1IP1 antibody-based research methods .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.