MAF Antibody, Biotin conjugated

Shipped with Ice Packs
In Stock

Description

Definition and Characteristics

The MAF Antibody is a rabbit-derived polyclonal antibody conjugated with biotin, a high-affinity ligand for streptavidin/avidin systems. Key characteristics include:

  • Immunogen: Synthetic peptide targeting the N-terminal region of human MAF (sequence: MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLI) .

  • Reactivity: Predicted cross-reactivity with homologs in human, mouse, rat, cow, dog, guinea pig, horse, pig, rabbit, and zebrafish (Table 1) .

  • Molecular Weight: 38 kDa (Uniprot ID: O75444) .

Table 1: Predicted Species Reactivity

SpeciesSequence Homology (%)
Human100
Mouse100
Rat100
Cow100
Dog82
Guinea Pig79
Horse82
Pig82
Rabbit82
Zebrafish93

Applications and Uses

The antibody is validated for immunohistochemistry (IHC) and Western blot (WB), with protocols optimized for detecting MAF in tissues such as placenta and kidney . Its biotin conjugation enables versatile detection via streptavidin-linked reporters (e.g., HRP, fluorophores) .

Key Applications:

  • IHC: Detects nuclear and cytoplasmic MAF expression in tissues .

  • WB: Identifies MAF at ~38 kDa in lysates .

  • Multiplexing: Biotin-streptavidin systems allow co-detection with other antibodies in dual IHC .

Conjugation Methods

Biotinylation of the MAF antibody likely employs site-specific targeting of the Fc domain using methods like the ZBPA (Z-domain from Protein A) conjugation, which minimizes off-target labeling . This approach avoids non-specific amine/carboxyl conjugation seen in kits like Lightning-Link, reducing background noise .

Advantages of Biotin Conjugation :

  • High signal amplification via streptavidin-avidin complexes.

  • Compatibility with diverse detection systems (e.g., tyramide-based amplification) .

Functional Role of MAF

MAF regulates transcriptional activation/repression in:

  • Lens development: Promotes crystallin gene expression .

  • Chondrocyte differentiation: Mediates hypertrophic chondrocyte disappearance .

  • Oncogenesis: Acts as context-dependent oncogene/tumor suppressor .

References

  1. Thermo Fisher Scientific. (2023). Biotin Labeled Secondary Antibodies.

  2. PMC. (2013). Antibodies Biotinylated Using a Synthetic Z-domain from Protein A.

  3. Biocompare. (2022). Biotin Conjugated Secondary Antibodies.

  4. PMC. (2018). Quantitative collision-induced unfolding differentiates model ADCs.

  5. Aviva Systems Biology. (2007). MAF Antibody - N-terminal region: Biotin.

  6. PubMed. (2005). Conjugation of antibodies to biotin.

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
We typically dispatch products within 1-3 working days after receiving your order. Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time estimates.
Synonyms
AS42 oncogene homolog antibody; Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene antibody; Avian musculoaponeurotic fibrosarcoma (v maf) antibody; c maf proto oncogene antibody; cMaf antibody; maf antibody; MAF_HUMAN antibody; MAF2 antibody; MGC71685 antibody; Proto oncogene c Maf antibody; Proto-oncogene c-maf antibody; Transcription factor Maf antibody; v maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) antibody; v maf musculoaponeurotic fibrosarcoma oncogene homolog antibody; V-maf musculoaponeurotic fibrosarcoma oncogene homolog antibody
Target Names
MAF
Uniprot No.

Target Background

Function
MAF (c-Maf) is a transcription factor that acts as a transcriptional activator or repressor. It plays a crucial role in various cellular processes including embryonic lens fiber cell development, T helper 2 (Th2) cell differentiation, and regulation of apoptosis. MAF interacts with other transcription factors and coactivators, influencing gene expression in specific contexts. Key functions include:
  • **Lens Development:** Recruits transcriptional coactivators CREBBP and/or EP300 to crystallin promoters, leading to upregulation of crystallin gene expression during lens fiber cell differentiation.
  • **Immune Response:** Activates the expression of IL4 in Th2 cells. Increases T-cell susceptibility to apoptosis by interacting with MYB and decreasing BCL2 expression.
  • **Hormone Regulation:** Together with PAX6, transactivates the glucagon gene promoter through the G1 element.
  • **Endothelial Cell Function:** Activates transcription of the CD13 proximal promoter in endothelial cells. Represses transcription of the CD13 promoter in early stages of myelopoiesis by affecting the ETS1 and MYB cooperative interaction.
  • **Bone Development:** Involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development.
  • **Transcriptional Binding:** Binds to specific DNA sequences in the promoters of various genes, including the L7 promoter, alpha- and beta-crystallin gene promoters, glucagon promoter, and the CD13 proximal promoter in endothelial cells.
  • **Anti-oxidant Response:** When overexpressed, represses anti-oxidant response element (ARE)-mediated transcription. Binds to the ARE sites of detoxifying enzyme gene promoters.
  • **Cancer:** Involved in tumorigenesis, potentially acting as an oncogene or tumor suppressor depending on the cellular context.
Gene References Into Functions
  1. A common variant, rs889472, of c-MAF is associated with gout susceptibility. PMID: 29080939
  2. Two heterozygous rare variants in genes involved in early cataract development were identified: the novel c.809C>A; p.(Ser270Tyr) in MAF and the c.168C>G; p.(Tyr56 *) variant in CRYGD, previously reported as pathogenic. PMID: 28849415
  3. UBE2O mediates c-Maf polyubiquitination and degradation, inducing MM cell apoptosis and suppressing myeloma tumor growth, providing a novel insight into myelomagenesis and UBE2O biology. PMID: 28673317
  4. The interaction between c-Maf and RORgammat, and Blimp-1 is significant. PMID: 28300844
  5. Polymorphisms rs9939609 (FTO gene) and rs1424233 (MAF gene) were genotyped using allelic discrimination assays in a prospective multicenter cohort study. These polymorphisms were not associated with birth weight, BMI and Ponderal Index at discharge, and weight gain, regardless of dominant, additive, or recessive models. PMID: 23840443
  6. Genes associated with MAF-binding enhancers are suppressed in macrophages isolated from rheumatoid-arthritis patients, revealing a disease-associated signature of IFN-gamma-mediated repression. PMID: 28813657
  7. Increased expression of sIL6R from myeloid cells and subsequent c-Maf induction were adverse events for counteracting tumor-specific Th1 generation. Targeting sIL6R may improve the efficacy of T-cell-mediated cancer immunotherapy. PMID: 28235765
  8. MAF and GSK3 play a significant role in the resistance of t(14;16) multiple myeloma to proteasome inhibitors. PMID: 27793878
  9. The interplay between MATalpha1, c-Myc, and Maf proteins, and their deregulation during chronic cholestasis may facilitate cholangiocarcinoma oncogenesis. PMID: 26969892
  10. Epidermal differentiation gene regulatory networks are controlled by MAF and MAFB. PMID: 27097296
  11. Reactive oxygen species (ROS) have strong effects on multiple stem cell functions, with a central role for c-Maf in stem cell senescence. PMID: 26496036
  12. FGF signaling up-regulates expression of alphaA-crystallin both directly and indirectly via up-regulation of c-Maf. PMID: 26719333
  13. MAF is a mediator of breast cancer bone metastasis. 16q23 gain or MAF protein overexpression in tumors may help to select patients at risk of bone relapse. PMID: 26376684
  14. Cataract-associated mutations in MAF differentially affect the transactivation of MAF target crystalline genes. PMID: 25064449
  15. c-MAF ubiquitination and degradation are strictly regulated. PMID: 25448412
  16. Disease-causing mutations impair proper MAF phosphorylation, ubiquitination, and proteasomal degradation, perturbing gene expression in primary skin fibroblasts and inducing neurodevelopmental defects in an in vivo model. PMID: 25865493
  17. MAF mediates crosstalk between Ras-MAPK and mTOR signaling in NF1. PMID: 24509877
  18. LPS promotes PDCD4 degradation via a pathway involving PI3K and mTOR, releasing Twist2, which induces IL-10 via c-Maf. PMID: 24982420
  19. TMEM18, BDNF, MTCH2, and NEGR1 have a regulatory role in adipocyte differentiation and biology. MAF expression varies during adipogenesis, while NPC1, PTER, and SH2B1 are not regulated. PMID: 23229156
  20. c-Maf increases human immunodeficiency virus (HIV)-1 expression in interleukin (IL)-4-producing CD4 T cells by binding the proximal HIV-1 long terminal repeat region (LTR) and augmenting HIV-1 transcription. PMID: 22875803
  21. Bcl6 and Maf collaborate to orchestrate a suite of genes that define core characteristics of human Tfh cell biology. PMID: 22427637
  22. The transcription factor c-Maf is crucial for mechanosensory function. Sensitivity to high-frequency vibration is reduced in humans carrying a dominant mutation in the c-MAF gene. PMID: 22345400
  23. The mechanisms underlying IL-2 regulation of C-MAF expression in human T cells were investigated. PMID: 21876034
  24. Hepatitis C virus impairs the induction of cytoprotective Nrf2 target genes by delocalizing small Maf proteins. PMID: 21216956
  25. The MEK-ERK pathway regulates MAF transcription. PMID: 21163924
  26. Methionine adenosyltransferase II serves as a transcriptional corepressor of Maf oncoprotein. PMID: 21362551
  27. Monocyte-derived macrophages with CD14 of high-antigen positivity display increased expression of c-Maf, which upregulates production of two key factors (hyaluronan and interleukin-10) that promote growth of Mycobacterium tuberculosis. PMID: 21209279
  28. c-Maf interacts with Ubc9 & PIAS1. c-Maf can be SUMOylated at Lys-33 in vitro. SUMOylation attenuates its transcriptional activity. PMID: 20127678
  29. A novel role for MAF as a transcriptional repressor was identified, preventing expression of blood vessel endothelial cells-specific genes, thereby maintaining the differentiation status of lymphatic endothelial cells. PMID: 20080955
  30. Tc-mip plays a critical role in the Th2 signaling pathway and is the first proximal signaling protein that links TCR-mediated signal to the activation of c-maf, a Th2 specific factor. PMID: 12939343
  31. The short form of the proto-oncogene c-maf is highly induced in minimal change nephrotic syndrome T cells during relapse, where it translocates to the nuclear compartment and binds to the DNA responsive element. PMID: 14688382
  32. High levels of c-maf mRNA are associated with multiple myeloma. PMID: 14692531
  33. c-maf transforms plasma cells by stimulating cell cycle progression and altering bone marrow stromal interactions. PMID: 14998494
  34. c-Maf plays a role in the transcriptional regulation of IL-10 in macrophages. PMID: 15749884
  35. c-Maf might cause a type of T-cell lymphoma in both mice and humans. ARK5, cyclin D2, and integrin beta(7) might be downstream target genes of c-Maf leading to malignant transformation. PMID: 16424013
  36. The mutation spectrum of MAF in association with congenital cataract was expanded, highlighting the genetic and phenotypic heterogeneity of congenital cataract. PMID: 16470690
  37. Segmental allergen challenge in asthmatics leads to increased GATA-3, c-maf, and T-bet expression in BAL cells but not in bronchial biopsies. PMID: 16498264
  38. OPN is significantly upregulated in MM patients with maf translocations, particularly in the fraction lacking bone disease. PMID: 17044113
  39. c-Maf interacts with c-Myb, reducing promoter binding and decreasing Bcl-2 expression, making CD4 T cells more prone to apoptosis. PMID: 17823980
  40. The differential DNA binding specificity between Maf homodimers and Nrf2-Maf heterodimers establishes the differential gene regulation by these dimer-forming transcription factors. PMID: 17875642
  41. CD13 transcription is regulated by MAF via an atypical response element. PMID: 17897790
  42. Pax-6 and c-Maf interact with G1 to activate basal expression of the glucagon gene. PMID: 17901057
  43. MAF mutation p.Arg299Ser is the third mutation identified in association with the CCMC phenotype. All three mutations are located in the basic region of the DNA binding domain in the MAF protein (OMIM 177075). PMID: 17982426
  44. Angioimmunoblastic T-cell lymphoma (AILT) shows c-Maf expression, providing new insight into the pathogenesis of AILT and suggesting c-Maf as a useful diagnostic marker. PMID: 18059226
  45. MafG-mediated nuclear retention enables Nrf2 proteins to evade cytosolic proteasomal degradation and consequently stabilize Nrf2 signaling. PMID: 18585411
  46. The exclusion of specific genes supports the hypothesis that the ocular phenotype associated with Peters' anomaly segregating in this family is a distinct, new, autosomal dominant entity in the anterior segment dysgenesis spectrum. PMID: 18616618
  47. In addition to FTO and MC4R, significant association of obesity was detected with three new risk loci in NPC1 (endosomal/lysosomal Niemann-Pick C1 gene), near MAF (encoding the transcription factor c-MAF), and near PTER (phosphotriesterase-related gene). PMID: 19151714
  48. c-maf may be important in chondrocyte hypertrophy and terminal differentiation and may be involved in the pathogenesis of osteoarthritis. PMID: 19215682
  49. Detection of c-Maf may be particularly valuable in the differential diagnosis of small cell lymphomas. PMID: 19687312

Show More

Hide All

Database Links

HGNC: 6776

OMIM: 177075

KEGG: hsa:4094

STRING: 9606.ENSP00000327048

UniGene: Hs.134859

Involvement In Disease
Cataract 21, multiple types (CTRCT21); Ayme-Gripp syndrome (AYGRP)
Protein Families
BZIP family, Maf subfamily
Subcellular Location
Nucleus.
Tissue Specificity
Expressed in endothelial cells.

Q&A

What is MAF protein and why is it significant in research?

MAF (c-MAF) is a transcription factor belonging to the bZIP family and Maf subfamily that functions as both a transcriptional activator and repressor. It plays crucial roles in embryonic lens fiber cell development and T cell apoptosis regulation through interaction with MYB and modulation of BCL2 expression. MAF also works with PAX6 to transactivate the glucagon gene promoter through the G1 element. Its involvement in multiple cellular pathways makes it a significant target in developmental biology, immunology, and cancer research, particularly breast cancer where MAF amplification increases metastasis risk .

How does biotin conjugation of antibodies enhance detection systems?

Biotin conjugation enhances detection by leveraging the high-affinity interaction between biotin and avidin/streptavidin. This biochemical partnership allows for signal amplification in techniques like immunohistochemistry, where multiple enzyme molecules can be localized to a single antigen site. The tetravalent nature of avidin/streptavidin (four binding sites for biotin) creates a detection system where one primary antibody binding event can lead to the attachment of multiple reporter enzymes, significantly increasing sensitivity. For MAF detection, this amplification is particularly valuable when studying low-abundance transcription factors in complex tissue samples .

What is the optimal protocol for using biotinylated MAF antibodies in immunohistochemistry?

The optimal protocol for using biotinylated MAF antibodies in immunohistochemistry follows the LSAB (Labeled Streptavidin-Biotin) method:

  • Tissue preparation: Fix tissue sections with 10% neutral buffered formalin and perform antigen retrieval (typically heat-induced in citrate buffer pH 6.0)

  • Block endogenous biotin: Apply avidin/biotin blocking kit before antibody incubation to prevent non-specific binding

  • Primary antibody application: Incubate sections with biotinylated MAF antibody at 1:50-1:500 dilution for 1 hour at room temperature or overnight at 4°C

  • Reporter enzyme detection: Apply enzyme-conjugated streptavidin (HRP or AP) and incubate for 30-60 minutes

  • Signal development: Add appropriate substrate (DAB for HRP; BCIP/NBT for AP)

  • Counterstain and mount

This method offers improved tissue penetration compared to the ABC method while maintaining high sensitivity, which is particularly important given MAF's nuclear localization and variable expression levels across different cell types .

How should researchers design experiments to study MAF protein interactions using biotinylated antibodies?

For studying MAF protein interactions, researchers should design experiments using proximity-dependent biotin identification (BioID2) methodology:

  • Generate MAF fusion constructs: Create expression vectors with MAF (both short and long isoforms) fused to BioID2 enzyme with appropriate tags (HA or myc) at either N- or C-terminus

  • Validate expression and localization: Confirm nuclear localization of fusion proteins via immunofluorescence

  • Perform in vivo biotinylation: Culture transfected cells with biotin supplementation (typically 50μM) for 24 hours

  • Cell lysis and pulldown: Lyse cells under denaturing conditions and perform streptavidin pulldown

  • Identify interacting partners: Analyze co-precipitated proteins via tandem mass spectrometry (nanoLC-MS/MS)

  • Validate high-confidence interactors: Confirm key interactions through alternative methods (co-IP, FRET)

  • Perform comparative analysis: Compare interaction networks between different cell types (e.g., ER+ vs. ER- breast cancer cells) to identify context-specific interactions

This approach allows detection of both stable and transient interactions, providing comprehensive insights into MAF's regulatory networks in different cellular contexts .

What controls are necessary when using biotinylated MAF antibodies in Western blot applications?

When using biotinylated MAF antibodies in Western blot applications, several controls are essential:

  • Positive tissue/cell controls: Include lysates from tissues or cell lines with confirmed MAF expression (A431, A375, HeLa, HepG2, or K-562 cells)

  • Molecular weight verification: Confirm detection at the expected molecular weight range (42-52 kDa for MAF)

  • Blocking control: Perform parallel blots with pre-incubation of antibody with immunizing peptide to confirm specificity

  • Endogenous biotin control: Run a lane with streptavidin-HRP only (no primary antibody) to identify endogenously biotinylated proteins

  • Loading control: Probe for housekeeping proteins (β-actin, GAPDH) to normalize protein loading

  • Antibody titration: Perform dilution series (1:1000-1:8000) to determine optimal signal-to-noise ratio

  • Non-biotinylated MAF antibody comparison: Run parallel blots with biotinylated and non-biotinylated versions to assess any detection differences

These controls ensure specificity, accuracy, and reliable quantification when detecting MAF protein, particularly important given its variable expression patterns and potential post-translational modifications affecting apparent molecular weight .

How can researchers address high background issues when using biotinylated MAF antibodies?

High background with biotinylated MAF antibodies can be addressed through systematic troubleshooting:

  • Endogenous biotin blocking: Apply avidin/biotin blocking kit before antibody incubation, especially crucial for biotin-rich tissues like liver, kidney, and mammary tissue

  • Optimize antibody concentration: Titrate the biotinylated MAF antibody using dilution series (starting at 1:50-1:500 for IF/ICC and 1:1000-1:8000 for WB)

  • Increase washing stringency: Use Tris-buffered saline with 0.1-0.3% Tween-20 and extend washing times

  • Add protein blockers: Include 1-5% BSA or 5-10% normal serum from the same species as the secondary reagent

  • Reduce streptavidin-conjugate concentration: Dilute enzyme-conjugated streptavidin further if specific signal is still detectable

  • Use alternative detection systems: Consider NeutrAvidin instead of streptavidin/avidin to reduce non-specific binding

  • Preabsorb antibodies: Incubate diluted antibody with acetone powder of the relevant tissue to remove cross-reactive antibodies

This methodical approach helps distinguish between true MAF protein signal and artifact, particularly important given MAF's role as a transcription factor that may be present at low abundance in some cell types .

What factors affect the stability and performance of biotinylated MAF antibodies in long-term storage?

The stability and performance of biotinylated MAF antibodies are influenced by several factors:

  • Storage temperature: Maintain at -20°C (not -80°C, which can cause freeze-thaw damage to the biotin-antibody linkage)

  • Buffer composition: Presence of 0.02% sodium azide and 50% glycerol at pH 7.3 preserves antibody function

  • Aliquoting practices: Divide into single-use aliquots upon receipt to avoid repeated freeze-thaw cycles

  • Light exposure: Minimize exposure to light, particularly for antibodies with fluorescent conjugates

  • Contamination prevention: Use sterile technique when handling to prevent microbial growth

  • Stabilizing additives: Small amounts (0.1%) of BSA in smaller volume preparations help prevent protein adsorption to tube walls

  • Conjugation chemistry: N-hydroxysuccinimide ester-mediated biotinylation provides greater stability than alternative methods

Under optimal storage conditions (-20°C with stabilizing buffer), biotinylated MAF antibodies maintain their activity for approximately one year after shipment, after which gradual reduction in signal intensity may be observed .

How can researchers validate the specificity of biotinylated MAF antibodies in their experimental system?

Validating biotinylated MAF antibody specificity requires multiple complementary approaches:

  • Genetic validation: Test in MAF-knockout or MAF-knockdown cells/tissues compared to wild-type

  • Peptide competition: Pre-incubate antibody with immunizing peptide to block specific binding

  • Multiple antibody comparison: Test multiple antibodies against different MAF epitopes

  • Signal localization assessment: Confirm nuclear localization consistent with transcription factor function

  • Molecular weight verification: Confirm detection at the expected 42-52 kDa range in Western blot

  • Cross-species reactivity: Test in multiple species to confirm expected conservation patterns

  • Positive control tissues: Validate in tissues with known MAF expression (e.g., lens fiber cells)

  • siRNA knockdown recovery: Perform knockdown-rescue experiments with wild-type and mutant MAF

  • Recombinant protein controls: Include purified MAF protein as positive control

This multi-faceted validation approach ensures that signals detected across different experimental techniques genuinely represent MAF protein rather than cross-reactive or non-specific binding, particularly important given the shared domains between MAF and other bZIP family transcription factors .

How can biotinylated MAF antibodies be utilized to study MAF's role in breast cancer metastasis?

Biotinylated MAF antibodies can be strategically employed to investigate MAF's role in breast cancer metastasis through:

  • Tissue microarray analysis: Evaluate MAF expression across primary tumors and metastatic lesions using biotinylated antibodies with LSAB detection for enhanced sensitivity in archived samples

  • Co-localization studies: Perform multiplex immunofluorescence with biotinylated MAF antibodies and markers for epithelial-mesenchymal transition to identify cells undergoing metastatic transformation

  • ChIP-seq analysis: Use biotinylated MAF antibodies in chromatin immunoprecipitation followed by sequencing to map MAF binding sites genome-wide in metastatic versus non-metastatic cells

  • Proximity ligation assays: Combine biotinylated MAF antibodies with antibodies against potential interacting partners (e.g., ERα) to visualize protein-protein interactions in situ

  • Patient-derived xenograft models: Track MAF expression patterns during metastatic progression in PDX models using biotinylated antibodies

  • Circulating tumor cell detection: Develop sensitive detection systems for MAF-expressing CTCs using biotinylated antibodies and streptavidin-based magnetic enrichment

  • Drug response markers: Correlate MAF expression (detected via biotinylated antibodies) with response to anti-metastatic therapies

This comprehensive approach provides mechanistic insights into how MAF amplification licenses ERα through epigenetic remodeling, promoting metastasis in breast cancer, with potential therapeutic implications .

What methodological approaches can researchers use to investigate the interaction between MAF and other transcription factors?

To investigate interactions between MAF and other transcription factors, researchers can implement these methodological approaches:

  • BioID proximity labeling: Express MAF-BioID2 fusion proteins in relevant cell types to identify proximal proteins through biotinylation and streptavidin pulldown followed by mass spectrometry

  • Sequential ChIP: Perform chromatin immunoprecipitation first with biotinylated MAF antibodies, then with antibodies against suspected interacting transcription factors to identify co-occupied genomic regions

  • FRET-FLIM analysis: Use fluorescently labeled antibodies against MAF and potential partner proteins to measure Förster resonance energy transfer via fluorescence lifetime imaging microscopy

  • Bimolecular fluorescence complementation: Split fluorescent protein complementation assays with MAF and candidate interactors to visualize interactions in living cells

  • Proteomics of isolated chromatin segments: Combine MAF ChIP with mass spectrometry to identify proteins associated with MAF at specific genomic loci

  • RIME (Rapid Immunoprecipitation Mass spectrometry of Endogenous proteins): Cross-link protein complexes in situ and immunoprecipitate with biotinylated MAF antibodies for mass spectrometry analysis

  • High-throughput yeast two-hybrid screening: Screen MAF against transcription factor libraries to identify novel interactions

These approaches have revealed that MAF interacts with CREBBP and forms networks of 126 high-confidence interactors, including 71 common interactions across different experimental conditions, providing insight into its context-specific activity in different cell types .

How can researchers integrate biotinylated MAF antibody data with transcriptomic analyses?

Integrating biotinylated MAF antibody data with transcriptomic analyses requires a multi-omics approach:

  • MAF ChIP-seq with RNA-seq correlation: Perform ChIP-seq using biotinylated MAF antibodies concurrently with RNA-seq to correlate MAF binding sites with differential gene expression

  • Single-cell multi-omics: Combine single-cell immunodetection of MAF protein (using biotinylated antibodies) with scRNA-seq in the same cells to correlate protein levels with transcriptional profiles

  • Spatial transcriptomics integration: Overlay MAF immunohistochemistry (using biotinylated antibodies) with spatial transcriptomics data to correlate MAF protein localization with regional gene expression patterns

  • CUT&Tag-seq: Utilize biotinylated MAF antibodies in CUT&Tag protocols to map genome-wide binding with higher signal-to-noise ratio than traditional ChIP-seq

  • Perturbation response integration: Correlate changes in MAF binding (detected with biotinylated antibodies) with transcriptomic changes following drug treatment or genetic manipulation

  • Enhancer activity correlation: Integrate MAF binding data with enhancer RNA sequencing to identify functional enhancers regulated by MAF

  • 3D genome organization: Combine MAF binding data with Hi-C or similar chromosome conformation capture techniques to understand MAF's role in genome architecture

This integrated approach has revealed how MAF amplification in breast cancer licenses ERα through epigenetic remodeling, affecting transcriptional programs that drive metastasis .

How should researchers analyze variations in MAF detection across different tissue types?

When analyzing variations in MAF detection across tissues, researchers should implement this systematic approach:

  • Normalization strategies: Use multiple housekeeping proteins as internal controls, selecting those with stable expression across the specific tissues being compared

  • Tissue-specific positive controls: Include tissues with known high MAF expression (e.g., lens fiber cells) as positive control benchmarks

  • Quantification methods: Apply digital image analysis with tissue-specific thresholding to account for background differences

  • Cellular heterogeneity adjustment: Perform cell-type deconvolution analysis when working with heterogeneous tissue samples

  • Technical variation control: Process all compared tissues simultaneously with identical reagent lots and conditions

  • Antibody penetration assessment: Evaluate section thickness impact on signal intensity, especially in tissues with different densities

  • Endogenous biotin blocking verification: Implement more stringent biotin blocking for biotin-rich tissues like liver and kidney

  • Statistical approaches: Use ANOVA with post-hoc tests to determine significant differences, accounting for multiple comparisons

This approach enables accurate comparison of MAF expression across different experimental conditions, providing insights into its tissue-specific regulatory roles while minimizing technical artifacts .

What are the limitations of using biotinylated MAF antibodies in functional assays?

Biotinylated MAF antibodies have several important limitations in functional assays:

  • Complement activation impairment: Biotinylation significantly reduces the ability of antibodies to activate the classical complement pathway due to blocked C1q binding to Fc regions

  • Altered functional effects: Biotinylated antibodies show diminished capacity to sensitize target cells to complement-dependent lysis compared to their non-biotinylated counterparts

  • Steric hindrance: The biotin moiety may interfere with antibody-antigen interactions in certain epitopes, particularly those near lysine residues used for biotinylation

  • Neutralization capacity: While biotinylation does not affect antigen binding for many antibodies, it may alter the neutralizing capacity in functional blocking assays

  • ADCC limitations: Biotinylation can affect antibody-dependent cellular cytotoxicity by interfering with Fc receptor recognition

  • Limited tissue penetration: The larger size of avidin-biotin complexes may restrict tissue penetration in certain applications

  • Avidity effects: Multivalent binding through biotin-avidin interactions may create artificial avidity effects not present with native antibodies

These limitations are particularly relevant when studying MAF's functional interactions with other proteins or attempting to neutralize its activity, making non-biotinylated antibodies preferable for many functional applications .

How can researchers accurately quantify MAF protein levels using biotinylated antibodies?

Accurate quantification of MAF protein using biotinylated antibodies requires comprehensive calibration and controls:

  • Standard curve generation: Create calibration curves using recombinant MAF protein at known concentrations

  • Dynamic range determination: Establish the linear detection range by testing serial dilutions of positive control samples

  • Reference standard inclusion: Include a common reference sample across all experiments to normalize between batches

  • Multiple epitope targeting: Use biotinylated antibodies targeting different MAF epitopes to confirm measurements

  • Absolute quantification: Implement AQUA (Absolute Quantification) peptides as internal standards for mass spectrometry validation

  • Digital pathology tools: Apply machine learning algorithms for automated quantification of immunohistochemistry signals

  • Single-cell analysis: Combine flow cytometry with biotinylated MAF antibodies and streptavidin-fluorophore detection for single-cell protein quantification

  • Comparison to orthogonal methods: Validate protein levels using alternative techniques like ELISA and Western blot

This rigorous approach enables reliable quantification of MAF protein levels while accounting for the signal amplification inherent to biotin-streptavidin detection systems. This is particularly important when studying subtle changes in MAF expression during disease progression or in response to treatment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.