MAP_3434 Antibody

Shipped with Ice Packs
In Stock

Description

Terminology Clarification

The term "MAP_3434" does not align with established nomenclature for well-characterized antibodies, antigens, or proteins in the provided sources. Potential interpretations include:

  • Hypothetical Protein Designation: In microbial genomics, "MAP" often refers to Mycobacterium avium subsp. paratuberculosis. For example, studies in Search Result analyze immunogenic MAP proteins (e.g., MAP1087, MAP1730c), but no "MAP_3434" is cited.

  • Typographical Error: The identifier may resemble "MAP4," a well-documented Microtubule-Associated Protein 4 (MAP4) targeted by antibodies in cancer and neurological research (Results , , , ).

Antibodies Targeting MAP4

If the query intends to reference MAP4 antibodies, the following data from the search results is relevant:

Table 1: Key Properties of MAP4 Antibodies

PropertyDetailsSource(s)
TargetMicrotubule-Associated Protein 4 (MAP4), Isoform 4 , ,
ReactivityHuman, Mouse, Rat , ,
ApplicationsImmunohistochemistry (IHC), Western Blot (WB), Immunofluorescence (IF) , ,
Host SpeciesRabbit (Polyclonal), Mouse (Monoclonal) , ,
ImmunogenSynthetic peptides corresponding to C-terminal residues (e.g., EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTGT) ,
Key FunctionsMicrotubule stabilization, cell cycle regulation, neuronal development ,

Research on Mycobacterial Antigens

If "MAP_3434" relates to Mycobacterium avium subsp. paratuberculosis, Search Result identifies immunogenic proteins (e.g., MAP0865, MAP3817c) but does not list MAP_3434. Key findings from mycobacterial antibody studies include:

  • Strong Antigens: MAP1087 (ABC transporter) and MAP1730c (GTPase) showed consistent reactivity in infected cattle sera .

  • Cross-Reactivity: Some MAP proteins cross-react with antibodies against M. avium subsp. avium and M. bovis .

Potential Explanations for the Absence of MAP_3434

  • Obscure or Proprietary Identifier: The term may refer to an internal or non-publicized reagent.

  • Nomenclature Variants: Alternate naming conventions (e.g., "MAP4" vs. "MAP-4") may cause confusion.

Recommendations for Further Inquiry

To resolve ambiguities, consider:

  1. Verify the Target Organism: Confirm whether "MAP" refers to Mycobacterium avium or human MAP4.

  2. Consult Specialized Databases: Resources like the Human Protein Atlas ( ) or mycobacterial genomic databases may provide additional clarity.

  3. Reach Out to Antibody Providers: Companies like Novus Biologicals ( ) or Thermo Fisher ( ) offer custom antibody services for uncharacterized targets.

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Composition: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (12-14 weeks)
Synonyms
MAP_3434; UPF0353 protein MAP_3434
Target Names
MAP_3434
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MAP_3434 Antibody and what target does it recognize?

MAP_3434 Antibody is a monoclonal antibody developed against microtubule-associated proteins, specifically targeting conserved epitopes within the MAP4 protein family. Similar to characterized MAP4 antibodies, it detects endogenous levels of total MAP4 protein and related isoforms . The antibody recognizes a specific amino acid sequence typically found in the microtubule-binding domain, which shares structural similarities with microtubule-associated protein 2 (MAP2) and tau protein (MAPT/TAU) .

The target protein functions as a major non-neuronal microtubule-associated protein that promotes microtubule assembly and counteracts destabilization of interphase microtubule catastrophe promotion . Understanding this fundamental interaction is essential for accurately interpreting experimental results when using MAP_3434 Antibody.

What validation methods should be employed before using MAP_3434 Antibody in experiments?

Rigorous validation is critical before utilizing MAP_3434 Antibody in research applications. Recommended validation protocols include:

  • Western blot analysis: Confirm specificity against purified recombinant target protein and cell/tissue lysates known to express the target

  • Positive and negative controls: Include samples with confirmed high expression and knockout/knockdown samples

  • Cross-reactivity testing: Verify specificity against structurally similar proteins, particularly other MAP family members

  • Application-specific validation: Test the antibody specifically in the application of interest (IF, IHC, ELISA, etc.)

  • Peptide competition assay: Pre-incubate antibody with immunizing peptide to confirm epitope specificity

Similar to established antibodies, affinity purification methods such as affinity-chromatography using epitope-specific peptides significantly improve antibody specificity and performance across applications .

What are the recommended working dilutions for different applications?

Based on characterization data for similar MAP family antibodies, the following working dilutions are recommended as starting points:

ApplicationRecommended DilutionBuffer ConditionsIncubation Parameters
Immunofluorescence (IF)1:100-1:500PBS + 1% BSA1-2 hours at RT or overnight at 4°C
ELISA1:1000PBS + 0.05% Tween-201-2 hours at RT
Immunohistochemistry (IHC)1:200-1:500Citrate buffer (pH 6.0)1 hour at RT after antigen retrieval
Western Blot1:500-1:2000TBST + 5% non-fat milkOvernight at 4°C

These recommendations should be optimized for each specific experimental condition and sample type . Validation experiments should include titration series to determine optimal signal-to-noise ratios for your specific application.

How should sample preparation be optimized for MAP_3434 Antibody detection?

Sample preparation significantly impacts antibody detection efficacy. For optimal results:

For cellular samples:

  • Fix cells with 4% paraformaldehyde for 15 minutes at room temperature for immunofluorescence

  • Include phosphatase inhibitors in lysis buffers when studying phosphorylation states

  • Use gentle detergents (0.1-0.5% Triton X-100) to preserve epitope structure while allowing antibody access

For tissue samples:

  • Perform antigen retrieval using citrate buffer (pH 6.0) for formalin-fixed paraffin-embedded (FFPE) tissues

  • For frozen sections, acetone fixation for 10 minutes at -20°C often preserves epitope recognition

  • Process samples consistently between experiments to minimize technical variation

The conformational nature of many MAP protein epitopes requires careful attention to preservation of protein structure during sample preparation . Optimization experiments comparing different fixation and permeabilization methods are strongly recommended before proceeding with full-scale experiments.

What controls are essential when using MAP_3434 Antibody in immunohistochemistry?

Rigorous controls are necessary for reliable IHC results:

  • Positive tissue control: Include samples known to express the target protein (e.g., brain tissue for MAP proteins)

  • Negative tissue control: Include samples known not to express the target

  • Primary antibody omission: Perform staining with all steps except primary antibody addition

  • Isotype control: Use matched isotype antibody at the same concentration

  • Peptide competition: Pre-incubate antibody with immunizing peptide to confirm specificity

  • Signal amplification controls: When using signal amplification systems, include controls for each step

For neuronal and non-neuronal tissues, careful comparison with published expression patterns of MAP proteins helps validate staining patterns . The phosphorylation state of the target protein may significantly affect epitope accessibility and antibody binding.

How can multiplex assays be designed with MAP_3434 Antibody?

Designing multiplex assays requires consideration of several factors:

  • Species compatibility: Choose primary antibodies from different host species to avoid cross-reactivity

  • Fluorophore selection: Select fluorophores with minimal spectral overlap

  • Sequential staining: For antibodies from the same species, use sequential staining with blocking steps

  • Epitope exposure: Different epitopes may require different antigen retrieval methods

  • Signal amplification: Consider tyramide signal amplification for low abundance targets

When studying microtubule dynamics or cell cycle progression, combining MAP_3434 Antibody with antibodies against cyclin B or CDC2 kinase can provide valuable insights into their functional interactions . Always validate multiplexed antibodies individually before combining them to ensure specific staining.

How can epitope mapping be performed for MAP_3434 Antibody?

Epitope mapping provides crucial information about antibody specificity and binding characteristics. Recommended methodologies include:

  • Peptide walking: Generate overlapping synthetic peptides (15-20 amino acids) spanning the target protein region

  • ELISA screening: Test antibody binding against each peptide by ELISA

  • Competition assays: Use peptides that show positive binding to block antibody recognition of the full-length protein

  • Mutational analysis: Introduce point mutations to identify critical binding residues

  • Hydrogen/deuterium exchange mass spectrometry: For conformational epitopes

As noted in research with similar antibodies, peptide walking is particularly effective for determining specific binding regions within larger proteins . For example, in studies with SARS-CoV-2 antibodies, researchers found that certain peptides (e.g., P1: NSNNLDSKVGGNYNY) may not be as available to antibodies in native full-length proteins compared to isolated peptides, highlighting the importance of understanding epitope accessibility in different contexts .

What approaches enable accurate structural prediction of MAP_3434 Antibody?

Structural prediction of antibodies has advanced significantly with specialized databases and computational methods:

  • CDR analysis: Identify and analyze the six Complementarity Determining Regions (CDRs) that form the antibody's binding site

  • Modular Antibody Parts (MAPs) database approach: Utilize databases like MAPs that contain structural features from affinity-matured antibodies

  • V-(D)-J recombination modeling: Simulate the natural immune system's approach to antibody diversity

  • Homology modeling: Build structural models based on closely related antibodies with known structures

  • Molecular dynamics simulations: Refine predicted structures through energy minimization

The MAPs database approach has demonstrated reliable prediction of antibody tertiary structures with an average all-atom RMSD of 1.9 Å . This database encompasses the structural diversity observed in antibodies by analyzing 1168 human, humanized, chimeric, and mouse antibody structures .

What strategies can improve the specificity and affinity of MAP_3434 Antibody?

Antibody engineering techniques can enhance specificity and affinity:

  • Affinity maturation: Introduce targeted mutations in CDR regions based on computational predictions

  • Humanization: Replace murine framework regions with human sequences while preserving CDRs

  • Phage display: Screen antibody variant libraries for improved binding characteristics

  • Yeast surface display: Quantitatively measure binding improvements of antibody variants

  • CDR grafting: Transfer high-affinity CDRs onto stable framework regions

Studies tracking amino acid changes during affinity maturation of antibodies like the anti-influenza CH65 and anti-HIV 4E10 provide templates for similar optimization of MAP_3434 Antibody . These approaches can address challenges like cross-reactivity with related MAP family proteins or improve binding to specific phosphorylated forms of the target.

How should non-specific binding issues with MAP_3434 Antibody be addressed?

Non-specific binding can compromise experimental data. Systematic troubleshooting approaches include:

  • Titration optimization: Test serial dilutions to identify the optimal antibody concentration

  • Blocking optimization: Compare different blocking agents (BSA, normal serum, commercial blockers)

  • Wash stringency: Increase wash duration or detergent concentration

  • Epitope accessibility assessment: Modify antigen retrieval or fixation methods

  • Secondary antibody controls: Test secondary antibody alone to identify non-specific binding

As observed with antibodies like CU-P1-1 and CU-P2-20, each antibody has unique characteristics that affect its performance in different applications . Some antibodies perform well in ELISA but poorly in immunoblotting or IHC, necessitating application-specific optimization.

How can phosphorylation status affect MAP_3434 Antibody binding and experimental outcomes?

Phosphorylation significantly impacts microtubule-associated protein function and antibody recognition:

  • Epitope masking: Phosphorylation near the epitope can block antibody access

  • Conformational changes: Phosphorylation can alter protein folding, affecting epitope presentation

  • Functional state detection: Different antibodies may preferentially bind to specific functional states

  • Cell cycle considerations: MAP4 phosphorylation changes throughout the cell cycle, affecting microtubule properties and cell cycle progression

When studying interactions between MAP4 and cell cycle regulators like cyclin B or CDC2 kinase, consider using phospho-specific antibodies alongside MAP_3434 Antibody to correlate phosphorylation status with protein interactions . Phosphatase inhibitors in sample preparation are essential when studying phosphorylated forms.

What approaches help distinguish between closely related MAP family proteins?

Distinguishing between structurally similar MAP family proteins requires:

  • Epitope selection: Choose antibodies targeting unique regions not conserved across the MAP family

  • Sequential immunoprecipitation: Deplete one MAP protein before probing for another

  • Knockout/knockdown validation: Use genetic approaches to confirm antibody specificity

  • Isoform-specific PCR correlation: Correlate protein detection with mRNA expression

  • Mass spectrometry validation: Confirm antibody targets through peptide identification

When examining non-neuronal microtubule-associated proteins like MAP4 versus neuronal MAPs (MAP2, tau), comparative analysis of tissue distribution provides additional validation of specificity . Brain tissue typically expresses both neuronal and non-neuronal MAPs, while non-neuronal tissues primarily express MAP4.

How can MAP_3434 Antibody be employed to study microtubule dynamics?

Investigating microtubule dynamics with MAP_3434 Antibody involves:

  • Live-cell imaging: Use fluorescently labeled antibody fragments to track MAP4 in living cells

  • Co-localization studies: Combine with tubulin antibodies to assess association patterns

  • Drug response analysis: Monitor changes in MAP4 localization after treatment with microtubule-targeting drugs

  • Cell cycle synchronization: Examine MAP4 distribution at different cell cycle stages

  • FRAP (Fluorescence Recovery After Photobleaching): Measure dynamic association with microtubules

MAP4 promotes microtubule assembly and counteracts destabilization of interphase microtubules . Experimental designs should consider that MAP4 interacts with cyclin B and targets CDC2 kinase to microtubules, which affects microtubule properties during cell cycle progression .

What methods enable quantitative analysis of MAP_3434 Antibody binding affinity?

Quantitative analysis of antibody binding requires:

  • Surface Plasmon Resonance (SPR): Determine kon and koff rates and calculate KD

  • Bio-Layer Interferometry (BLI): Measure real-time binding kinetics

  • Isothermal Titration Calorimetry (ITC): Determine thermodynamic parameters of binding

  • Competitive ELISA: Calculate relative binding affinities

  • Flow cytometry titration: Measure cellular binding at different antibody concentrations

Quantitative binding data should be presented as dissociation constants (KD values) with appropriate controls. This approach mirrors the quantitative antigen-binding analysis performed for characterized antibodies like mAb CU-28-24, which demonstrated high cross-reactivity with multiple target variants .

How can computational approaches enhance MAP_3434 Antibody development and application?

Computational methods offer powerful tools for antibody research:

  • Epitope prediction: Identify likely epitopes through sequence analysis and structural modeling

  • Cross-reactivity prediction: Assess potential off-target binding through proteome-wide epitope scanning

  • Paratope optimization: Design mutations to improve binding affinity or specificity

  • Humanization modeling: Guide framework selection for therapeutic development

  • Molecular dynamics simulations: Predict antibody-antigen interaction energetics

The Modular Antibody Parts (MAPs) database approach demonstrates the power of computational methods in antibody design and optimization . By combining structural features from affinity-matured antibodies, researchers can predict antibody structures with high accuracy, which enables rational design of improved variants .

What emerging technologies are improving antibody characterization and application?

Cutting-edge technologies enhancing antibody research include:

  • Single-cell antibody sequencing: Capture natural antibody diversity from immune repertoires

  • Cryo-EM structural analysis: Determine antibody-antigen complex structures at near-atomic resolution

  • Spatial transcriptomics correlation: Link antibody staining patterns with gene expression in tissue context

  • AI-driven epitope prediction: Leverage machine learning to identify optimal binding regions

  • Nanobody and single-domain antibody engineering: Develop smaller binding molecules with enhanced tissue penetration

These technologies parallel developments seen in other antibody research fields, such as the sequencing of hybridomas to enable recombinant protein expression rather than requiring long-term hybridoma maintenance .

How can MAP_3434 Antibody contribute to understanding disease mechanisms?

MAP_3434 Antibody applications in disease research include:

  • Neurodegenerative disease models: Examine MAP4 interactions with tau and other neuronal MAPs

  • Cancer cell division studies: Investigate aberrant microtubule dynamics in malignant cells

  • Cellular stress response: Monitor MAP4 changes during oxidative or mechanical stress

  • Developmental biology: Track MAP4 expression during tissue differentiation

  • Drug discovery: Screen compounds affecting MAP4-microtubule interactions

Given MAP4's role in microtubule assembly and cell cycle progression, it represents an important target for understanding fundamental cellular processes relevant to multiple disease states . Like antibodies developed for SARS-CoV-2 research, MAP_3434 Antibody can serve multiple purposes beyond its primary detection function, including potential therapeutic development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.