met8 Antibody

What is METTL8 and what are the key applications of METTL8 antibodies?

METTL8 (Methyltransferase-like protein 8) is a protein primarily localized in mitochondria that functions as a tRNA N(3)-cytidine methyltransferase. In humans, the canonical protein consists of 291 amino acid residues with a molecular weight of approximately 33.4 kDa . METTL8 is involved in specific modification of mitochondrial tRNAs (mt-tRNA Ser(UCN) and mt-tRNA Thr), which is critical for proper mitochondrial translation and respiratory chain function .

METTL8 antibodies are commonly used in several applications:

• Western Blot (WB): The most widely used application for detecting METTL8 protein expression levels

• Enzyme-Linked Immunosorbent Assay (ELISA): For quantitative measurement of METTL8 levels

• Immunohistochemistry (IHC): For tissue localization studies

• Immunocytochemistry (ICC): For cellular and subcellular localization studies, particularly to confirm mitochondrial localization

These antibodies are valuable for studying METTL8's role in RNA modification pathways, mitochondrial translation, and its potential implications in diseases such as aggressive pancreatic cancer where METTL8 overexpression has been observed .

What species reactivity is available for METTL8 antibodies and how should researchers select the appropriate antibody?

METTL8 antibodies are available with reactivity to multiple species due to the conservation of the protein across different organisms. Commercially available antibodies typically offer reactivity to:

• Human (Homo sapiens)

• Mouse (Mus musculus)

• Rat (Rattus norvegicus)

Additionally, METTL8 gene orthologs have been reported in bovine, zebrafish, chimpanzee, and chicken species . When selecting an appropriate antibody, researchers should consider:

• The target species in their experimental model

• Sequence homology between species (e.g., one specific antibody shows 83% sequence identity to mouse and 82% to rat orthologs )

• The intended application (WB, IHC, ELISA, ICC)

• The specific epitope recognized by the antibody (some antibodies target specific regions like the middle region )

• The antibody format (polyclonal vs. monoclonal)

Researchers should review validation data for their species of interest and consider testing multiple antibodies if studying novel models or applications where validation data is limited.

How do anti-MET antibodies differ from METTL8 antibodies in terms of target and application?

While both are referred to as "MET" antibodies in some contexts, they target entirely different proteins with distinct functions and research applications:

METTL8 Antibodies:

• Target: Methyltransferase-like protein 8, a mitochondrial tRNA modification enzyme

• Size: Detect a protein of approximately 33.4 kDa

• Function: Study RNA methylation, mitochondrial translation, and tRNA modifications

• Applications: Primarily used in basic research to understand RNA modification mechanisms

Anti-MET Antibodies:

• Target: Mesenchymal-Epithelial Transition factor (MET), a receptor tyrosine kinase

• Function: Investigate cancer signaling pathways, especially in non-small cell lung cancer (NSCLC)

• Therapeutic relevance: Used to study potential targeted cancer therapies

• Advanced formats: Include biparatopic antibodies (targeting two distinct epitopes) and antibody-drug conjugates

The distinction is critical as researchers need to ensure they're using the appropriate antibody for their specific research question. MET antibodies are more frequently used in cancer research and therapeutic development, while METTL8 antibodies are typically employed in studies of RNA modification and mitochondrial function .

How can researchers validate the specificity of METTL8 antibodies?

Validating the specificity of METTL8 antibodies is crucial for ensuring reliable research results. Researchers should employ multiple complementary approaches:

Genetic Controls:

• Use METTL8 knockout (KO) cell lines as negative controls to confirm absence of signal

• Utilize METTL8 overexpression systems (such as METTL8-FLAG/HA constructs) to verify increased signal intensity

• Compare wild-type and METTL8-depleted samples to demonstrate signal reduction

Biochemical Validation:

• Perform peptide competition assays using the immunizing peptide (such as the sequence "MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE" for some antibodies)

• Test antibody against recombinant METTL8 protein

• Compare results using antibodies targeting different epitopes of METTL8

Cross-validation Methods:

• Compare results from multiple METTL8 antibodies (e.g., comparing commercially available antibodies from different suppliers)

• Use both tag-specific antibodies (e.g., anti-FLAG) and METTL8-specific antibodies on tagged constructs

• Cross-reference with orthogonal techniques like mass spectrometry

The search results demonstrate a validation approach: "We probed the METTL8-F/H-expressing cells with either antibodies against the FLAG tag (top panel, left) or a newly generated monoclonal antibody against METTL8 (top panel, right, Figure S1A, bottom; for METTL8 antibody validation)." This dual detection strategy provides stronger evidence of antibody specificity.

What are the critical considerations when using METTL8 antibodies for mitochondrial protein detection?

Detecting METTL8 in mitochondria requires special considerations due to the organelle's unique properties:

Sample Preparation:

• Optimize mitochondrial isolation techniques to enrich for METTL8 while minimizing contamination from other cellular compartments

• Select appropriate mitochondrial membrane permeabilization methods that maintain mitochondrial integrity while allowing antibody access

• Choose fixation protocols that preserve mitochondrial morphology without compromising epitope recognition

Co-localization Studies:

• Always include established mitochondrial markers as references, such as TOMM20 (outer membrane protein) or MitoTracker (mitochondrial dye)

• Use confocal or super-resolution microscopy to accurately distinguish mitochondrial localization from other granular cytoplasmic structures

• Perform Z-stack imaging to capture the three-dimensional distribution of METTL8 within mitochondria

Biochemical Fractionation:

• Complement imaging with mitochondrial fractionation experiments to confirm localization biochemically

• Verify mitochondrial fraction purity using markers for different cellular compartments

• Consider submitochondrial fractionation to determine METTL8's precise location within the mitochondria

Potential Challenges:

• Mitochondrial autofluorescence may interfere with immunofluorescence detection

• The granular appearance of mitochondria can be misinterpreted as non-specific antibody aggregation

• Previous contradictory reports of METTL8 localization (nuclear vs. mitochondrial) require careful validation

As demonstrated in the research: "To further corroborate mitochondrial localization, we performed biochemical fractionation experiments" after "we co-stained METTL8-FLAG- or -GFP-expressing cells with either antibodies against the outer membrane protein TOMM20 or MitoTracker."

How do biparatopic MET antibodies modulate receptor trafficking and what methodologies best capture this mechanism?

Biparatopic MET antibodies represent an advanced class of therapeutic antibodies that bind to two distinct epitopes on the MET receptor, dramatically affecting its cellular processing:

Mechanism of Action:

• Biparatopic MET antibodies recognize "two distinct epitopes in the MET Sema domain"

• Unlike conventional antibodies, they "inhibit MET recycling, thereby promoting lysosomal trafficking and degradation of MET"

• This results in minimal activation of MET-dependent biological responses and only "very transient downstream signaling"

Experimental Approaches to Study Trafficking:

• Receptor Internalization Assays:

  • Surface biotinylation followed by internalization tracking

  • Flow cytometry with non-permeabilized cells to quantify surface MET levels

  • Live-cell imaging with fluorescently labeled antibodies

• Degradation Analysis:

  • Pulse-chase experiments with metabolic labeling

  • Western blot time-course studies with cycloheximide treatment

  • Lysosomal inhibitors (e.g., chloroquine, bafilomycin A1) to confirm lysosomal degradation pathway

• Subcellular Localization Studies:

  • Co-localization with endosomal markers (early endosome: EEA1; recycling endosome: Rab11; lysosome: LAMP1)

  • Electron microscopy to visualize receptor in different vesicular compartments

  • Fractionation studies to biochemically track receptor trafficking

• Signaling Dynamics Assessment:

  • Phospho-specific antibodies to measure transient activation

  • Real-time biosensors for downstream effectors

  • Comparison with conventional antibodies or ligand stimulation

These methodologies have revealed that biparatopic antibodies exhibit "significantly better activity than either of the parental antibodies or the mixture of the two parental antibodies" and "outperform several clinical-stage MET antibodies" in MET-driven tumor models , making them promising therapeutic candidates.

How should researchers design experiments to investigate METTL8's role in mitochondrial translation?

Designing robust experiments to study METTL8's impact on mitochondrial translation requires careful planning:

Genetic Manipulation Strategies:

• Generate METTL8 knockout (KO) cell lines using CRISPR-Cas9 technology

• Create rescue lines expressing wild-type or catalytically inactive METTL8 mutants

• Develop inducible overexpression systems to study dose-dependent effects

• Establish cell lines expressing tagged versions (e.g., FLAG/HA-tagged METTL8) for immunoprecipitation studies

Translation Assessment Methods:

• Mitochondrial ribosome profiling to map ribosome occupancy across mitochondrial transcripts, especially focusing on codons corresponding to mt-tRNA Ser(UCN) and mt-tRNA Thr

• Pulse labeling with radiolabeled amino acids to measure mitochondrial protein synthesis rates

• Mass spectrometry to quantify changes in mitochondrially-encoded proteins, with particular attention to ND1 and ND6, which are most affected by METTL8 activity

• Polysome profiling of mitochondrial ribosomes to assess translation efficiency

tRNA Modification Analysis:

• Liquid chromatography-mass spectrometry to detect and quantify m3C modifications in mt-tRNAs

• Primer extension assays to map modification sites at single-nucleotide resolution

• tRNA microarrays to assess global changes in tRNA abundance and modification

• Northern blot analysis to examine changes in tRNA structure due to modifications

Functional Readouts:

• Oxygen consumption rate measurements to assess respiratory chain function

• Blue native PAGE to analyze respiratory complex assembly

• ATP production assays to quantify metabolic consequences of METTL8 manipulation

• Cell proliferation assays, particularly in cancer cell lines where METTL8 overexpression has been observed

As demonstrated in published research: "Using ribosome profiling in METTL8 KO and METTL8-overexpressing cells, we find that ribosomes are stalled specifically at mt-tRNA Ser(UCN) and mt-tRNA Thr codons, and mass spectrometry identifies that the mitochondrial proteins ND1 and ND6 are affected most by METTL8 activity."

What controls are essential when using MET antibodies in therapeutic efficacy studies?

When evaluating the therapeutic efficacy of MET antibodies in preclinical studies, several critical controls must be included:

Antibody-Related Controls:

• Isotype-matched control antibodies to account for Fc-mediated effects

• Parental antibodies (when testing biparatopic or conjugated antibodies) to establish baseline activity

• Commercially available or clinical-stage MET antibodies as benchmarks

• Antibody fragments (Fab, F(ab')₂) to distinguish between binding and Fc-dependent functions

Genetic and Pharmacological Controls:

• MET-knockout cells as negative controls for antibody specificity

• MET-amplified vs. normal MET expression models to assess specificity for overexpressed targets

• MET-mutant models (exon 14 skipping) to evaluate efficacy against clinically relevant mutations

• Small molecule MET inhibitors as alternative mechanism controls

Model System Considerations:

• Multiple cell lines with varying levels of MET dependency

• Both in vitro (cell viability, migration, invasion) and in vivo (tumor growth, metastasis) assays

• Patient-derived xenograft models to better reflect clinical heterogeneity

• Immunocompetent models when evaluating antibodies with potential immune-engaging functions

Mechanistic Validation:

• Downstream signaling analysis (phospho-MET, phospho-ERK, phospho-AKT)

• Receptor trafficking studies to confirm the proposed mechanism of action

• Combination studies with other targeted therapies (e.g., EGFR inhibitors) to assess synergy potential

• Resistance development studies to evaluate durability of response

What methodological approaches best capture METTL8's role in RNA modification and how should antibodies be incorporated?

Investigating METTL8's RNA modification function requires specialized approaches that effectively combine antibody techniques with RNA analysis:

RNA Methylation Detection Methods:

• RNA bisulfite sequencing to identify m3C modifications at single-nucleotide resolution

• Mass spectrometry to quantify global m3C levels in different RNA species

• Antibody-based m3C immunoprecipitation followed by sequencing (m3C-IP-seq)

• In vitro methylation assays using immunopurified METTL8 and synthetic RNA substrates

RNA-Protein Interaction Analysis:

• RNA Immunoprecipitation (RIP) using METTL8 antibodies to capture associated RNAs

• Crosslinking and Immunoprecipitation (CLIP) to identify direct binding sites

• Photoactivatable Ribonucleoside-Enhanced Crosslinking (PAR-CLIP) for enhanced resolution

• Proximity ligation assays to visualize RNA-protein interactions in situ

Integrative Approaches:

• Combine METTL8 knockout/overexpression with transcriptome and epitranscriptome analysis

• Correlate tRNA modification levels with ribosome profiling data at specific codons

• Compare RNA modifications with protein expression changes by mass spectrometry

• Assess mitochondrial function parameters in response to METTL8-mediated tRNA modifications

Antibody Implementation Strategies:

• Use METTL8 antibodies for immunoprecipitation before RNA extraction and analysis

• Employ antibodies for immunofluorescence to correlate METTL8 localization with RNA processing sites

• Apply antibodies in Western blots to confirm METTL8 expression levels in experimental models

• Utilize multiple antibodies recognizing different METTL8 epitopes to validate results

Research has shown that "METTL8 specifically catalyzes the m3C modification of mt-tRNA Ser(UCN) and mt-tRNA Thr" and "METTL8 knockout (KO) leads to unmodified tRNAs and compromised respiratory chain activity." These findings were established through integrative approaches combining genetic manipulation with comprehensive RNA and protein analysis.

Why might Western blot detection of METTL8 show unexpected bands or molecular weights?

Unexpected bands or molecular weight variations in METTL8 Western blots can occur for several reasons:

Biological Factors:

• Isoforms: "Up to 2 different isoforms have been reported for this protein" , which could appear as distinct bands

• Post-translational modifications: Phosphorylation, ubiquitination, or other modifications can alter migration

• Proteolytic processing: METTL8 may undergo cleavage during mitochondrial import

• Protein complexes: Incomplete denaturation may preserve METTL8-containing complexes

Technical Considerations:

• Sample preparation: Insufficient denaturation or reduction can cause abnormal migration

• Gel percentage: Inappropriate acrylamide percentage may affect resolution of a 33.4 kDa protein

• Running conditions: Voltage, buffer composition, and temperature can impact migration

• Transfer efficiency: Inconsistent transfer, particularly with PVDF membranes

Antibody-Specific Issues:

• Epitope specificity: Some antibodies may recognize related methyltransferases in the METL family

• Cross-reactivity: Sequence similarity with other proteins (particularly other methyltransferases)

• Antibody quality: Lot-to-lot variation or degradation can lead to non-specific binding

• Detection system: Overly sensitive detection methods may reveal minor cross-reactivity

Troubleshooting Approach:

• Validate with multiple antibodies targeting different epitopes of METTL8

• Compare with tagged METTL8 expression detected by tag antibodies (as demonstrated in the dual-detection approach in the literature)

• Include METTL8 KO samples as negative controls

• Try different lysis and denaturing conditions specifically optimized for mitochondrial proteins

• Perform peptide competition assays using the immunogen sequence to confirm specificity

From the search results, METTL8 has "a reported length of 291 amino acid residues and a mass of 33.4 kDa," providing a reference point for expected migration in Western blots.

What factors affect the sensitivity and specificity of anti-MET antibodies in tumor tissue analysis?

When using anti-MET antibodies for tumor tissue analysis, several factors can significantly impact sensitivity and specificity:

Tissue Processing Factors:

• Fixation method: Formalin fixation time can affect epitope preservation and accessibility

• Antigen retrieval: Different methods (heat-induced vs. enzymatic) may be required depending on the epitope

• Tissue section thickness: Thicker sections may require adjusted antibody concentrations

• Tissue age: Archival samples may show reduced antigenicity compared to fresh specimens

Antibody Selection Considerations:

• Clone specificity: Different antibody clones recognize distinct MET epitopes, affecting detection of specific mutations

• Antibody format: Monoclonal vs. polyclonal antibodies offer different sensitivity/specificity profiles

• Binding domain: Antibodies targeting the Sema domain (like biparatopic antibodies) vs. other MET domains

• Detection of MET alterations: Some antibodies may preferentially detect wild-type MET over exon 14 skipping mutants

Technical Protocol Variables:

• Blocking methodology: Incomplete blocking increases background signal

• Antibody concentration: Optimal dilution requires careful titration for each tissue type

• Incubation conditions: Temperature, duration, and diluent composition affect binding efficiency

• Detection system: Sensitivity of chromogenic vs. fluorescent systems varies significantly

Interpretation Challenges:

• Heterogeneous expression: MET expression can vary within the same tumor sample

• Distinguishing overexpression: Determining clinically relevant threshold levels for MET positivity

• Membrane vs. cytoplasmic staining: Differentiating between functional and internalized receptor

• Subcellular localization changes: Trafficking alterations in response to therapies

When evaluating MET expression as a biomarker, researchers should "focus on developing novel MET antibody drugs and exploring new therapeutic combinations" while "refining biomarker-driven approaches to ensure precise patient selection." This requires careful validation of antibody performance in the specific context of each study.

How can researchers address inconsistent results when comparing METTL8 antibody data with functional outcomes?

Addressing inconsistencies between METTL8 antibody data and functional outcomes requires systematic troubleshooting:

Experimental Design Improvements:

• Comprehensive controls: Include positive controls (METTL8 overexpression), negative controls (METTL8 knockout), and appropriate isotype controls

• Multiple detection methods: Verify METTL8 expression using both antibody-based (Western blot, ICC) and non-antibody methods (mRNA quantification)

• Time-course experiments: Assess whether temporal differences in METTL8 expression vs. functional effects explain discrepancies

• Dose-response relationships: Determine whether threshold effects exist between METTL8 levels and functional outcomes

Technical Validation Approaches:

• Multiple antibodies: Use antibodies recognizing different epitopes to confirm consistent detection

• Complementary techniques: Compare antibody staining patterns with tagged METTL8 constructs detected via their tags

• Subcellular fractionation: Verify whether the antibody efficiently detects mitochondrial METTL8

• Epitope accessibility: Consider whether conformational changes or protein interactions might mask epitopes in functional states

Biological Complexity Considerations:

• Isoform-specific functions: Determine whether different METTL8 isoforms have distinct functional roles

• Post-translational modifications: Assess whether METTL8 activity is regulated by modifications that don't affect antibody recognition

• Protein-protein interactions: Investigate whether METTL8 function depends on interaction partners

• Compensatory mechanisms: Consider whether other methyltransferases compensate for METTL8 changes

Analytical Strategies:

• Correlation analysis: Quantitatively correlate METTL8 levels with functional readouts across multiple experiments

• Single-cell approaches: Determine whether population heterogeneity explains inconsistent results

• Integrative data analysis: Combine antibody data with RNA-seq, ribosome profiling, and proteomics to build a comprehensive model

• Computational modeling: Use systems biology approaches to understand complex relationships between METTL8 levels and downstream effects

Research has shown that METTL8's effects on mitochondrial function are mediated through specific tRNA modifications, with downstream effects on proteins like ND1 and ND6 . This mechanistic pathway should be considered when reconciling antibody data with functional outcomes.

How can METTL8 antibodies be used to study the relationship between RNA modification and cancer metabolism?

METTL8 antibodies offer valuable tools for investigating the emerging connection between RNA modification and cancer metabolism:

Tumor Tissue Analysis:

• Use METTL8 antibodies for immunohistochemistry of tumor microarrays to quantify expression across cancer types and stages

• Compare METTL8 levels between normal and tumor tissues to identify cancer-specific alterations

• Correlate METTL8 expression with patient outcomes and treatment responses

• Examine spatial distribution within heterogeneous tumors through multiplex immunofluorescence

Metabolic Pathway Investigation:

• Combine METTL8 immunoprecipitation with RNA-seq to identify cancer-specific RNA targets

• Correlate METTL8 expression with mitochondrial respiratory complex activity using functional assays

• Investigate the relationship between METTL8-mediated tRNA modification and translation of metabolic enzymes

• Compare metabolic profiles (using metabolomics) between METTL8-high and METTL8-low cancer cells

Pancreatic Cancer Models:

• Use METTL8 antibodies to validate overexpression in pancreatic cancer cell lines and patient samples

• Perform knockdown/knockout studies to assess dependency on METTL8 for cancer cell survival

• Measure changes in respiratory chain activity following METTL8 modulation

• Combine with metabolic flux analysis to track carbon sources and energy production pathways

Therapeutic Development Applications:

• Screen for compounds that modulate METTL8 expression or activity

• Monitor METTL8 levels in response to current cancer therapies

• Develop antibody-drug conjugates targeting cancer cells with high METTL8 expression

• Use METTL8 antibodies to assess the efficacy of RNA-targeted therapeutics

As reported in the literature: "METTL8 overexpression is observed in highly aggressive pancreatic cancer cells, which are accompanied by a markedly enhanced respiratory chain activity. Such a METTL8 addiction of pancreatic cancer cells might be a valuable novel target for RNA therapeutics." This finding opens new avenues for targeted cancer therapy based on RNA modification mechanisms.

What are the methodological considerations when using anti-MET antibodies in combination with other targeted therapies?

Using anti-MET antibodies in combination with other targeted therapies requires careful methodological planning:

Antibody Selection and Characterization:

• Choose antibodies with well-defined mechanisms of action (e.g., biparatopic antibodies that promote MET degradation )

• Consider bispecific antibodies like amivantamab that simultaneously target MET and EGFR

• Characterize potential interactions between antibodies and small molecule inhibitors

• Determine whether sequential or simultaneous administration is optimal

Mechanistic Studies Design:

• Assess pathway crosstalk using phospho-specific antibodies for key nodes in signaling networks

• Investigate compensatory upregulation of alternative pathways following single-agent treatment

• Examine receptor dynamics (internalization, degradation, recycling) when targeting multiple receptors

• Study combined effects on downstream cellular processes (proliferation, migration, survival)

Resistance Modeling:

• Develop resistant cell lines through long-term exposure to single agents

• Test whether combination approaches overcome established resistance mechanisms

• Use genetic approaches (CRISPR screens) to identify mediators of resistance

• Analyze tumor samples before and after treatment failure to identify acquired alterations

Clinical Translation Considerations:

• Design rational combinations based on known resistance mechanisms (e.g., MET upregulation following EGFR inhibition)

• Establish appropriate biomarkers for patient selection in combination approaches

• Determine optimal dosing schedules to minimize toxicity while maximizing efficacy

• Develop companion diagnostics to identify patients likely to benefit from specific combinations

Research shows that "Amivantamab, a bispecific EGFR/MET antibody was approved to treat EGFR exon 20 insertion and now has recently been extended to target classical EGFR mutations with progression on osimertinib." This demonstrates the clinical value of antibody combinations targeting multiple oncogenic drivers simultaneously.