MIER2 Antibody

Shipped with Ice Packs
In Stock

Description

MIER2 Protein: Structure and Function

MIER2 is predominantly localized in the nucleus, where it interacts with transcription factors and chromatin remodeling complexes to modulate the transcription of target genes . It belongs to the evolutionarily conserved MIER family of proteins, which includes three members: MIER1, MIER2, and MIER3 . This family contributes significantly to histone deacetylase (HDAC) activity and actively participates in histone deacetylation processes . Recent research has revealed that in renal cell carcinoma, MIER2 represses PGC1A expression by recruiting HDAC1 to deacetylate P53, highlighting its potential role in cancer pathogenesis .

Types of MIER2 Antibodies

MIER2 antibodies are available in various forms, each with distinct characteristics suited for different research applications. Table 1 provides an overview of the main types currently available in the market.

Table 1: Types of MIER2 Antibodies

TypeHostDescriptionExamples
MonoclonalMouseSingle epitope specificity, consistent batch-to-batch reproducibilityMIER2 Antibody (E-2) , MIER2 Antibody (A-7) , MIER2 Mouse Monoclonal (OTI3A1)
PolyclonalRabbitMultiple epitope recognition, enhanced sensitivityMIER2 Antibody (NBP2-87804) , MIER2 antibody (17426-1-AP) , Anti-MIER2 antibody (ab235410)
RecombinantRabbitCombines monoclonal consistency with recombinant production benefitsMIER2 antibody (84216-1-RR) , MIER2 antibody (84216-1-PBS)

Monoclonal antibodies offer high specificity targeting single epitopes, ensuring consistent results across experiments. Mouse monoclonal antibodies like the E-2 clone detect epitopes within specific regions (e.g., amino acids 152-170) of human MIER2 .

Polyclonal antibodies recognize multiple epitopes on the MIER2 protein, potentially providing greater sensitivity in certain applications. These are typically generated in rabbits using synthetic peptides or recombinant protein fragments as immunogens .

Recombinant antibodies represent the newest generation, combining the specificity of monoclonals with enhanced batch-to-batch consistency. Proteintech's recombinant antibodies are produced using proprietary technology that enables reliable scaled production and future supply security .

Host Organisms and Isotypes

MIER2 antibodies are predominantly produced in either mouse or rabbit hosts. Mouse-derived antibodies are typically of the IgG1 κ isotype , while rabbit-derived antibodies are generally classified as IgG .

Immunogens and Epitopes

The immunogens used to produce MIER2 antibodies vary considerably:

  • Synthetic peptides targeting specific regions of human MIER2, such as the middle region sequence "ETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMT"

  • Recombinant protein fragments corresponding to amino acids 1-296 of human MIER2

  • MIER2 fusion proteins (e.g., Ag11491)

Epitopes recognized by monoclonal antibodies include amino acids 5-23 and 152-170 of human MIER2 , providing specific targeting capabilities.

Formulations and Physical Properties

Most commercial MIER2 antibodies are supplied in liquid form with various buffer compositions:

  • PBS with sodium azide (0.02-0.09%) and glycerol (50%)

  • PBS with sucrose (2%) for BSA-free formulations

  • Concentrations ranging from 0.2 mg/ml to 1 mg/ml

The observed molecular weight of MIER2 in experimental contexts is typically 60-70 kDa, consistent with its calculated weight based on amino acid sequence .

Applications in Research

MIER2 antibodies have been validated for numerous research applications, with varying recommended dilutions for optimal results. Table 2 summarizes the primary applications and dilution ranges.

Table 2: Research Applications and Recommended Dilutions

ApplicationValidated AntibodiesRecommended DilutionsCell/Tissue Types
Western Blot (WB)Most MIER2 antibodies1:1000-1:10000 , 1:1000-1:6000 , 1:2000 Jurkat, HepG2, HeLa, MCF-7, U2OS, HEK-293, A549
Immunoprecipitation (IP)E-2, A-7 clonesNot specifiedHuman samples
Immunofluorescence (IF)/Immunocytochemistry (ICC)Multiple antibodies1:200-1:800 , 1:100 A431, COS7 cells
Immunohistochemistry (IHC)Multiple antibodies1:150 , 1:100-1:300 Human kidney, liver, liver cancer tissues
Enzyme-linked Immunosorbent Assay (ELISA)Multiple antibodiesNot specifiedHuman samples
Cytometric bead array84216-1-PBSPart of matched antibody pairsHuman samples

Detection in Cell Lines

MIER2 antibodies have successfully detected native MIER2 protein in numerous human cell lines, demonstrating their utility across diverse experimental systems. Western blot analysis has confirmed MIER2 expression in U2OS, HEK-293, Jurkat, HepG2, HeLa, MCF-7, and A549 cells . Immunofluorescence applications have additionally validated MIER2 detection in A431 and transfected COS7 cells .

Tissue Expression Patterns

Immunohistochemical analyses have revealed MIER2 expression in human kidney, liver, and liver cancer tissues . This tissue distribution data provides valuable insights into the physiological relevance of MIER2 in different organ systems and potential implications in disease states.

Biological Function

The protein exerts its regulatory effects through interactions with transcription factors and chromatin remodeling complexes, modulating the transcription of target genes . MIER2 contributes to histone deacetylase activity and actively participates in histone deacetylation processes, suggesting a role in epigenetic regulation .

Molecular Interactions

Recent research has revealed specific molecular mechanisms through which MIER2 functions. In renal cell carcinoma, MIER2 has been shown to repress PGC1A expression by recruiting HDAC1 to deacetylate P53 . This interaction demonstrates MIER2's capacity to modulate the activity of tumor suppressors through epigenetic mechanisms.

Clinical Implications

Dysregulation of MIER2 has been implicated in developmental disorders and certain cancers . Its interaction with key tumor suppressors like P53 suggests potential roles in oncogenesis and tumor progression . The presence of MIER2 in liver cancer tissues further supports its potential involvement in hepatocellular carcinoma pathogenesis .

Product Specs

Buffer
PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid freeze/thaw cycles.
Lead Time
We typically dispatch orders within 1-3 business days of receipt. Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Synonyms
KIAA1193 antibody; mesoderm induction early response 1, family member 2 antibody; Mesoderm induction early response protein 2 antibody; Mi-er2 antibody; Mier2 antibody; MIER2_HUMAN antibody
Target Names
MIER2
Uniprot No.

Target Background

Function
MIER2 Antibody is a transcriptional repressor.
Gene References Into Functions
  1. Histone deacetylase assays have confirmed that MIER2 complexes, but not MIER3 complexes, exhibit associated deacetylase activity. PMID: 28046085
Database Links

HGNC: 29210

KEGG: hsa:54531

STRING: 9606.ENSP00000264819

UniGene: Hs.101891

Subcellular Location
Nucleus.

Q&A

What is MIER2 protein and what is its function in cellular biology?

MIER2 (mesoderm induction early response 1, family member 2), also known as Mi-er2 or KIAA1193, is a protein encoded by the MIER2 gene in humans. It functions primarily as a transcriptional repressor and is part of the MIER family of proteins that are evolutionarily conserved . This family includes three members: MIER1, MIER2, and MIER3, all of which contribute to histone deacetylase (HDAC) activity and actively participate in histone deacetylation processes . In particular, MIER2 has been shown to repress PGC1A expression in renal cell carcinoma by recruiting HDAC1 to deacetylate P53 . This indicates its potential role in cancer development and progression, making it an important target for oncological research.

What are the common applications for MIER2 antibodies in research?

MIER2 antibodies are utilized in several key research applications:

ApplicationDescriptionCommon Dilutions
Western Blot (WB)Detection of MIER2 protein in cell lysates1:200-1:10000
Immunohistochemistry (IHC)Localization of MIER2 in tissue sections1:100-1:300
Immunofluorescence (IF)/ICCVisualization of MIER2 in cells1:200-1:800
ELISAQuantification of MIER2 in samplesVaries by kit

These applications enable researchers to investigate MIER2 expression, localization, and interactions in various experimental setups . When selecting an application, researchers should consider the specific research question, sample type, and required sensitivity. For example, western blotting is excellent for confirming antibody specificity and quantifying relative protein levels, while IHC and IF provide spatial information about protein localization within tissues or cells.

What cell lines or tissues have confirmed MIER2 expression?

Based on available research data, MIER2 expression has been confirmed in several cell lines and tissues:

Sample TypeConfirmed Expression
Cell LinesHeLa cells, U2OS cells, HEK-293 cells, Jurkat cells, A431 cells
Human TissuesColon cancer tissue, Liver cancer tissue

In validation studies, MIER2 antibodies have shown reliable detection in these samples, with the protein typically observed at its calculated molecular weight of approximately 60 kDa . This information is particularly valuable for researchers selecting appropriate positive controls for their experiments or investigating MIER2 expression in new sample types.

How does MIER2 interact with histone deacetylases and what implications does this have for epigenetic research?

MIER2, as a member of the MIER family of proteins, contributes significantly to histone deacetylase (HDAC) activity through specific protein-protein interactions. Research has shown that MIER2 actively participates in histone deacetylation processes, suggesting an important role in epigenetic regulation . Specifically in renal cell carcinoma, MIER2 has been demonstrated to repress PGC1A expression by recruiting HDAC1 to deacetylate P53 . This mechanism illustrates how MIER2 functions as a transcriptional repressor through epigenetic modification.

For epigenetic researchers, this interaction presents several important implications. First, it positions MIER2 as a potential target for epigenetic drug development, particularly for cancers where aberrant histone deacetylation contributes to pathogenesis. Second, it suggests that MIER2 may serve as a biomarker for certain epigenetic states in cells or tissues. When designing experiments to investigate these interactions, researchers should consider using co-immunoprecipitation assays with MIER2 antibodies to pull down associated protein complexes, followed by western blotting or mass spectrometry to identify interaction partners.

What are the challenges in developing highly specific MIER2 antibodies and how can they be addressed?

Developing highly specific antibodies for MIER2 presents several significant challenges:

  • Structural similarity within the MIER family: MIER2 shares sequence homology with MIER1 and MIER3, creating potential cross-reactivity issues.

  • Limited epitope accessibility: Some epitopes may be poorly accessible in the native protein conformation.

  • Post-translational modifications: These can affect antibody recognition and binding efficiency.

  • Expression levels: MIER2 may be expressed at relatively low levels in some tissues, requiring antibodies with high sensitivity.

Recent advances in antibody development technology offer promising solutions to these challenges. Computational approaches that integrate high-throughput sequencing with machine learning techniques can now be employed to design antibodies with highly specific binding profiles . This biophysics-informed modeling can disentangle multiple binding modes associated with specific ligands, allowing for the design of antibodies that can discriminate between structurally and chemically similar targets .

What role might MIER2 play in cancer biology based on current antibody-based research?

Antibody-based research has begun to uncover potential roles for MIER2 in cancer biology, though our understanding remains incomplete. Immunohistochemistry studies using MIER2 antibodies have demonstrated its presence in human colon cancer and liver cancer tissues , suggesting possible involvement in these malignancies. More specifically, research has revealed that in renal cell carcinoma, MIER2 represses PGC1A expression by recruiting HDAC1 to deacetylate P53 , indicating a potential mechanism through which MIER2 might influence cancer development or progression.

Given MIER2's function as a transcriptional repressor and its interaction with histone deacetylases, it likely affects the expression of various genes involved in cell cycle regulation, apoptosis, or metabolism—all processes frequently dysregulated in cancer. Further antibody-based investigations are needed to:

  • Characterize MIER2 expression patterns across different cancer types and stages

  • Identify the specific gene networks regulated by MIER2 in different cancer contexts

  • Determine whether MIER2 expression correlates with patient outcomes or treatment responses

  • Explore MIER2 as a potential therapeutic target or biomarker

Researchers investigating these questions should consider employing tissue microarrays with MIER2 antibodies to efficiently screen multiple cancer samples, combined with co-localization studies to understand MIER2's interaction with other cancer-related proteins.

What are the optimal protocols for using MIER2 antibodies in Western Blotting?

For optimal Western Blotting results with MIER2 antibodies, researchers should follow these key protocol recommendations:

Sample Preparation:

  • Use freshly prepared cell lysates whenever possible

  • Include protease inhibitors in lysis buffers to prevent MIER2 degradation

  • Load adequate protein (30-50 μg per lane) as MIER2 may be expressed at moderate levels

Electrophoresis and Transfer:

  • Use 10% SDS-PAGE gels for optimal resolution around the 60 kDa mark where MIER2 is expected

  • Consider wet transfer methods for proteins of this size

Antibody Incubation:

  • For primary antibody: Use dilutions between 1:200-1:1000 for most MIER2 polyclonal antibodies or 1:2000-1:10000 for recombinant MIER2 antibodies

  • Incubate overnight at 4°C for best results

  • For HeLa cells, a dilution of 1:550 has been validated

Detection and Interpretation:

  • The expected molecular weight for MIER2 is approximately 60 kDa

  • Include positive control samples such as HeLa, U2OS, HEK-293, or Jurkat cell lysates

  • Consider using MIER2 knockout or knockdown samples as negative controls

Troubleshooting Considerations:

  • If nonspecific bands appear, increase blocking time or try different blocking reagents

  • If signal is weak, increase antibody concentration or extend incubation time

Following these guidelines should help researchers obtain clear, specific detection of MIER2 protein in their samples.

What are the critical considerations for immunohistochemistry (IHC) experiments with MIER2 antibodies?

Successful immunohistochemistry experiments with MIER2 antibodies require careful attention to several critical factors:

Tissue Preparation and Antigen Retrieval:

  • Proper fixation is crucial; overfixation can mask epitopes

  • Heat-induced epitope retrieval (HIER) using citrate buffer (pH 6.0) or EDTA buffer (pH 9.0) is recommended

  • Optimization of retrieval time may be necessary for different tissue types

Antibody Selection and Dilution:

  • For MIER2 polyclonal antibodies, dilutions between 1:100-1:300 are typically recommended

  • Validated dilutions include 1:50 for human colon cancer and liver cancer tissues

  • Consider using recombinant antibodies for increased consistency between experiments

Controls:

  • Include positive control tissues with known MIER2 expression (colon cancer or liver cancer samples have been validated)

  • Use isotype controls to assess background staining

  • Consider MIER2-negative tissues as negative controls

Signal Detection and Interpretation:

  • Be aware that MIER2, as a transcriptional repressor, may show nuclear localization

  • Compare staining patterns with published results

  • Quantify results using appropriate scoring systems for intensity and percentage of positive cells

Multiplex Considerations:

  • For co-localization studies with other proteins (e.g., HDAC1), ensure antibodies are raised in different host species

  • Validate each antibody independently before attempting multiplex IHC

Following these guidelines will help researchers obtain reliable, interpretable IHC results when investigating MIER2 expression in tissues.

How can researchers validate the specificity of their MIER2 antibodies?

Validating antibody specificity is critical for ensuring reliable experimental results. For MIER2 antibodies, comprehensive validation should include multiple complementary approaches:

Western Blot Validation:

  • Confirm the presence of a single band at the expected molecular weight (~60 kDa)

  • Test against cell lines with known MIER2 expression (e.g., HeLa, U2OS, HEK-293, Jurkat)

  • Include negative controls such as MIER2 knockout cell lines or MIER2 siRNA-treated samples

  • Test for cross-reactivity with recombinant MIER1 and MIER3 proteins to ensure specificity within the MIER family

Immunoprecipitation:

  • Perform immunoprecipitation followed by mass spectrometry to confirm that MIER2 is the primary protein being pulled down

  • Conduct reverse immunoprecipitation with another MIER2 antibody targeting a different epitope

Immunocytochemistry/Immunofluorescence:

  • Confirm expected subcellular localization patterns

  • Compare with published localization data

  • Perform co-localization studies with other markers

Peptide Competition Assay:

  • Pre-incubate the antibody with the immunizing peptide prior to the experiment

  • Signal should be significantly reduced or eliminated if the antibody is specific

Orthogonal Validation:

  • Compare protein expression results with mRNA expression data

  • Validate findings using multiple antibodies targeting different epitopes of MIER2

A table summarizing recommended validation experiments:

Validation MethodPurposeExpected Outcome for Specific Antibody
Western blotConfirm correct molecular weightSingle band at ~60 kDa
siRNA/CRISPR knockoutConfirm specificityReduced/absent signal
Peptide competitionVerify epitope specificityBlocked signal
Cross-reactivity testingEnsure MIER family specificityNo binding to MIER1/MIER3
Multiple antibody comparisonConfirm consistencySimilar patterns with different antibodies

By implementing these validation strategies, researchers can greatly increase confidence in their MIER2 antibody specificity and experimental results.

What are common issues encountered in MIER2 Western blot experiments and how can they be resolved?

Western blot experiments with MIER2 antibodies may encounter several common issues. Here are the most frequent problems and their solutions:

Weak or Absent Signal:

  • Potential Causes: Insufficient protein loading, antibody concentration too low, short exposure time, or low MIER2 expression in sample

  • Solutions: Increase protein loading (40-50 μg recommended), increase antibody concentration (try 1:200 for polyclonal or 1:2000 for recombinant antibodies ), extend primary antibody incubation to overnight at 4°C, use enhanced chemiluminescence detection systems, or verify MIER2 expression in your sample type

Multiple Bands or High Background:

  • Potential Causes: Antibody cross-reactivity, protein degradation, insufficient blocking, or non-specific binding

  • Solutions: Use freshly prepared samples with protease inhibitors, increase blocking time (2 hours at room temperature), use 5% non-fat dry milk or BSA in TBS-T for blocking, optimize antibody dilution (start with manufacturer recommendations), increase washing steps (5x5 minutes), or consider using a more specific MIER2 antibody

Incorrect Molecular Weight:

  • Potential Causes: Post-translational modifications, splice variants, or non-specific binding

  • Solutions: MIER2 should appear at approximately 60 kDa ; confirm with positive control samples (HeLa cells have been validated ); if bands appear at other molecular weights, check literature for known modifications or isoforms of MIER2

Inconsistent Results:

  • Potential Causes: Antibody batch variation, inconsistent transfer, or variable expression

  • Solutions: Use recombinant antibodies for better batch-to-batch consistency , standardize your protocol (especially transfer conditions), include positive controls in each experiment, and normalize MIER2 signal to housekeeping proteins

Troubleshooting Flowchart:

  • No signal → Check positive control → Still no signal → Increase antibody concentration → Still no signal → Try different antibody lot/source

  • High background → Increase blocking → Still high background → Increase washing steps → Still high background → Decrease antibody concentration

  • Multiple bands → Check for degradation → Still multiple bands → Verify with another MIER2 antibody → Still multiple bands → Consider siRNA validation

Implementing these troubleshooting strategies should help resolve most common issues encountered in MIER2 Western blot experiments.

How do researchers navigate contradictory results between different MIER2 antibodies?

When faced with contradictory results between different MIER2 antibodies, researchers should follow a systematic approach to resolve these discrepancies:

Understanding the Source of Discrepancies:

  • Epitope differences: Different antibodies may target distinct epitopes on MIER2, which could be differentially accessible depending on protein conformation, interaction partners, or post-translational modifications

  • Antibody format variations: Polyclonal versus monoclonal or recombinant antibodies may exhibit different specificities and sensitivities

  • Cross-reactivity issues: Some antibodies may cross-react with other MIER family members (MIER1, MIER3) or unrelated proteins

  • Application-specific performance: An antibody that works well in Western blot may not perform optimally in IHC or IF applications

Methodological Approach to Resolution:

  • Comprehensive validation of each antibody:

    • Confirm target specificity using MIER2 knockout or knockdown models

    • Perform peptide competition assays to verify epitope-specific binding

    • Check for cross-reactivity with recombinant MIER1 and MIER3 proteins

  • Orthogonal methods validation:

    • Compare protein detection results with mRNA expression data (RT-PCR, RNA-seq)

    • Use non-antibody-based methods (e.g., mass spectrometry) to confirm protein identity and abundance

    • Employ tagged MIER2 constructs and detect with tag-specific antibodies

  • Direct antibody comparison:

    • Test all antibodies under identical experimental conditions

    • Document the epitopes targeted by each antibody and consider how protein structure might affect accessibility

    • Contact manufacturers for technical support and validation data

  • Triangulation approach:

    • Consider results from multiple antibodies and methods as a collective dataset

    • Give more weight to results confirmed by multiple independent methods

    • Be transparent about discrepancies in publications and presentations

When discrepancies persist:

  • Report all conflicting results and potential explanations in publications

  • Consider that different results may reflect biological reality (e.g., different isoforms or modified forms of MIER2)

  • Design follow-up experiments specifically to address and resolve the contradictions

What strategies help optimize MIER2 antibody performance in challenging samples or applications?

Optimizing MIER2 antibody performance in challenging samples or applications requires tailored strategies to address specific difficulties:

For Samples with Low MIER2 Expression:

  • Implement signal amplification systems (e.g., tyramide signal amplification for IHC/IF)

  • Use more sensitive detection methods (e.g., enhanced chemiluminescence for Western blot)

  • Concentrate proteins through immunoprecipitation before Western blot analysis

  • Increase sample input and extend primary antibody incubation time (overnight at 4°C)

  • Consider using recombinant antibodies which may offer improved sensitivity

For Fixed Tissue Samples with Potential Epitope Masking:

  • Optimize antigen retrieval methods systematically:

    • Test both heat-induced epitope retrieval (HIER) and enzymatic retrieval

    • Compare different buffers (citrate pH 6.0, EDTA pH 9.0, Tris-EDTA)

    • Adjust retrieval times (10-30 minutes) and methods (microwave, pressure cooker)

  • Try antibodies targeting different MIER2 epitopes that may be less affected by fixation

  • Reduce fixation time in future samples if possible

For Complex Biological Fluids:

  • Pre-clear samples to remove components that may cause interference

  • Optimize blocking conditions using different blocking reagents (BSA, casein, commercial blockers)

  • Consider immunoprecipitation to isolate MIER2 before analysis

  • Implement additional washing steps with different buffer compositions

For Multiplex Applications:

  • Select MIER2 antibodies raised in different host species than other target antibodies

  • Validate each antibody individually before combining in multiplex formats

  • Use appropriate controls to assess and correct for spectral overlap in fluorescence applications

  • Consider sequential staining approaches for particularly challenging combinations

For Quantitative Applications:

  • Establish standard curves using recombinant MIER2 protein

  • Include appropriate internal and loading controls

  • Validate linearity of signal across a range of protein concentrations

  • Use image analysis software with appropriate background correction for quantification

For Novel Applications:

  • Consult literature for analogous proteins with similar characteristics to MIER2

  • Adapt established protocols from related nuclear or transcriptional regulator proteins

  • Begin with manufacturer-recommended conditions, then systematically optimize key variables

  • Consider computational modeling approaches to predict antibody specificity and optimal conditions

By implementing these tailored optimization strategies, researchers can enhance MIER2 antibody performance even in challenging experimental contexts, leading to more reliable and informative results.

What are the emerging research directions for MIER2 antibodies based on recent publications?

Recent research involving MIER2 antibodies points to several promising emerging directions. Current studies highlight MIER2's role in epigenetic regulation through interaction with histone deacetylases, particularly in the context of cancer biology . This suggests that MIER2 antibodies will become increasingly important tools for investigating epigenetic mechanisms in various disease states.

An exciting development in the field involves computational modeling approaches for antibody design. Recent work has demonstrated that biophysics-informed models can disentangle multiple binding modes associated with specific ligands, enabling the prediction and generation of antibody variants with customized specificity profiles . Applied to MIER2 research, these approaches could lead to the development of next-generation antibodies with enhanced specificity, particularly for distinguishing between MIER family members.

Additionally, the identification of MIER2's role in repressing PGC1A expression by recruiting HDAC1 to deacetylate P53 in renal cell carcinoma opens new avenues for investigating MIER2 as a potential therapeutic target. This will likely drive demand for highly specific MIER2 antibodies suitable for in vivo applications and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.