MIER2 is predominantly localized in the nucleus, where it interacts with transcription factors and chromatin remodeling complexes to modulate the transcription of target genes . It belongs to the evolutionarily conserved MIER family of proteins, which includes three members: MIER1, MIER2, and MIER3 . This family contributes significantly to histone deacetylase (HDAC) activity and actively participates in histone deacetylation processes . Recent research has revealed that in renal cell carcinoma, MIER2 represses PGC1A expression by recruiting HDAC1 to deacetylate P53, highlighting its potential role in cancer pathogenesis .
MIER2 antibodies are available in various forms, each with distinct characteristics suited for different research applications. Table 1 provides an overview of the main types currently available in the market.
Monoclonal antibodies offer high specificity targeting single epitopes, ensuring consistent results across experiments. Mouse monoclonal antibodies like the E-2 clone detect epitopes within specific regions (e.g., amino acids 152-170) of human MIER2 .
Polyclonal antibodies recognize multiple epitopes on the MIER2 protein, potentially providing greater sensitivity in certain applications. These are typically generated in rabbits using synthetic peptides or recombinant protein fragments as immunogens .
Recombinant antibodies represent the newest generation, combining the specificity of monoclonals with enhanced batch-to-batch consistency. Proteintech's recombinant antibodies are produced using proprietary technology that enables reliable scaled production and future supply security .
MIER2 antibodies are predominantly produced in either mouse or rabbit hosts. Mouse-derived antibodies are typically of the IgG1 κ isotype , while rabbit-derived antibodies are generally classified as IgG .
The immunogens used to produce MIER2 antibodies vary considerably:
Synthetic peptides targeting specific regions of human MIER2, such as the middle region sequence "ETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMT"
Recombinant protein fragments corresponding to amino acids 1-296 of human MIER2
Epitopes recognized by monoclonal antibodies include amino acids 5-23 and 152-170 of human MIER2 , providing specific targeting capabilities.
Most commercial MIER2 antibodies are supplied in liquid form with various buffer compositions:
The observed molecular weight of MIER2 in experimental contexts is typically 60-70 kDa, consistent with its calculated weight based on amino acid sequence .
MIER2 antibodies have been validated for numerous research applications, with varying recommended dilutions for optimal results. Table 2 summarizes the primary applications and dilution ranges.
MIER2 antibodies have successfully detected native MIER2 protein in numerous human cell lines, demonstrating their utility across diverse experimental systems. Western blot analysis has confirmed MIER2 expression in U2OS, HEK-293, Jurkat, HepG2, HeLa, MCF-7, and A549 cells . Immunofluorescence applications have additionally validated MIER2 detection in A431 and transfected COS7 cells .
Immunohistochemical analyses have revealed MIER2 expression in human kidney, liver, and liver cancer tissues . This tissue distribution data provides valuable insights into the physiological relevance of MIER2 in different organ systems and potential implications in disease states.
The protein exerts its regulatory effects through interactions with transcription factors and chromatin remodeling complexes, modulating the transcription of target genes . MIER2 contributes to histone deacetylase activity and actively participates in histone deacetylation processes, suggesting a role in epigenetic regulation .
Recent research has revealed specific molecular mechanisms through which MIER2 functions. In renal cell carcinoma, MIER2 has been shown to repress PGC1A expression by recruiting HDAC1 to deacetylate P53 . This interaction demonstrates MIER2's capacity to modulate the activity of tumor suppressors through epigenetic mechanisms.
Dysregulation of MIER2 has been implicated in developmental disorders and certain cancers . Its interaction with key tumor suppressors like P53 suggests potential roles in oncogenesis and tumor progression . The presence of MIER2 in liver cancer tissues further supports its potential involvement in hepatocellular carcinoma pathogenesis .
MIER2 (mesoderm induction early response 1, family member 2), also known as Mi-er2 or KIAA1193, is a protein encoded by the MIER2 gene in humans. It functions primarily as a transcriptional repressor and is part of the MIER family of proteins that are evolutionarily conserved . This family includes three members: MIER1, MIER2, and MIER3, all of which contribute to histone deacetylase (HDAC) activity and actively participate in histone deacetylation processes . In particular, MIER2 has been shown to repress PGC1A expression in renal cell carcinoma by recruiting HDAC1 to deacetylate P53 . This indicates its potential role in cancer development and progression, making it an important target for oncological research.
MIER2 antibodies are utilized in several key research applications:
| Application | Description | Common Dilutions |
|---|---|---|
| Western Blot (WB) | Detection of MIER2 protein in cell lysates | 1:200-1:10000 |
| Immunohistochemistry (IHC) | Localization of MIER2 in tissue sections | 1:100-1:300 |
| Immunofluorescence (IF)/ICC | Visualization of MIER2 in cells | 1:200-1:800 |
| ELISA | Quantification of MIER2 in samples | Varies by kit |
These applications enable researchers to investigate MIER2 expression, localization, and interactions in various experimental setups . When selecting an application, researchers should consider the specific research question, sample type, and required sensitivity. For example, western blotting is excellent for confirming antibody specificity and quantifying relative protein levels, while IHC and IF provide spatial information about protein localization within tissues or cells.
Based on available research data, MIER2 expression has been confirmed in several cell lines and tissues:
| Sample Type | Confirmed Expression |
|---|---|
| Cell Lines | HeLa cells, U2OS cells, HEK-293 cells, Jurkat cells, A431 cells |
| Human Tissues | Colon cancer tissue, Liver cancer tissue |
In validation studies, MIER2 antibodies have shown reliable detection in these samples, with the protein typically observed at its calculated molecular weight of approximately 60 kDa . This information is particularly valuable for researchers selecting appropriate positive controls for their experiments or investigating MIER2 expression in new sample types.
MIER2, as a member of the MIER family of proteins, contributes significantly to histone deacetylase (HDAC) activity through specific protein-protein interactions. Research has shown that MIER2 actively participates in histone deacetylation processes, suggesting an important role in epigenetic regulation . Specifically in renal cell carcinoma, MIER2 has been demonstrated to repress PGC1A expression by recruiting HDAC1 to deacetylate P53 . This mechanism illustrates how MIER2 functions as a transcriptional repressor through epigenetic modification.
For epigenetic researchers, this interaction presents several important implications. First, it positions MIER2 as a potential target for epigenetic drug development, particularly for cancers where aberrant histone deacetylation contributes to pathogenesis. Second, it suggests that MIER2 may serve as a biomarker for certain epigenetic states in cells or tissues. When designing experiments to investigate these interactions, researchers should consider using co-immunoprecipitation assays with MIER2 antibodies to pull down associated protein complexes, followed by western blotting or mass spectrometry to identify interaction partners.
Developing highly specific antibodies for MIER2 presents several significant challenges:
Structural similarity within the MIER family: MIER2 shares sequence homology with MIER1 and MIER3, creating potential cross-reactivity issues.
Limited epitope accessibility: Some epitopes may be poorly accessible in the native protein conformation.
Post-translational modifications: These can affect antibody recognition and binding efficiency.
Expression levels: MIER2 may be expressed at relatively low levels in some tissues, requiring antibodies with high sensitivity.
Recent advances in antibody development technology offer promising solutions to these challenges. Computational approaches that integrate high-throughput sequencing with machine learning techniques can now be employed to design antibodies with highly specific binding profiles . This biophysics-informed modeling can disentangle multiple binding modes associated with specific ligands, allowing for the design of antibodies that can discriminate between structurally and chemically similar targets .
Antibody-based research has begun to uncover potential roles for MIER2 in cancer biology, though our understanding remains incomplete. Immunohistochemistry studies using MIER2 antibodies have demonstrated its presence in human colon cancer and liver cancer tissues , suggesting possible involvement in these malignancies. More specifically, research has revealed that in renal cell carcinoma, MIER2 represses PGC1A expression by recruiting HDAC1 to deacetylate P53 , indicating a potential mechanism through which MIER2 might influence cancer development or progression.
Given MIER2's function as a transcriptional repressor and its interaction with histone deacetylases, it likely affects the expression of various genes involved in cell cycle regulation, apoptosis, or metabolism—all processes frequently dysregulated in cancer. Further antibody-based investigations are needed to:
Characterize MIER2 expression patterns across different cancer types and stages
Identify the specific gene networks regulated by MIER2 in different cancer contexts
Determine whether MIER2 expression correlates with patient outcomes or treatment responses
Explore MIER2 as a potential therapeutic target or biomarker
Researchers investigating these questions should consider employing tissue microarrays with MIER2 antibodies to efficiently screen multiple cancer samples, combined with co-localization studies to understand MIER2's interaction with other cancer-related proteins.
For optimal Western Blotting results with MIER2 antibodies, researchers should follow these key protocol recommendations:
Sample Preparation:
Use freshly prepared cell lysates whenever possible
Include protease inhibitors in lysis buffers to prevent MIER2 degradation
Load adequate protein (30-50 μg per lane) as MIER2 may be expressed at moderate levels
Electrophoresis and Transfer:
Use 10% SDS-PAGE gels for optimal resolution around the 60 kDa mark where MIER2 is expected
Consider wet transfer methods for proteins of this size
Antibody Incubation:
For primary antibody: Use dilutions between 1:200-1:1000 for most MIER2 polyclonal antibodies or 1:2000-1:10000 for recombinant MIER2 antibodies
Incubate overnight at 4°C for best results
Detection and Interpretation:
The expected molecular weight for MIER2 is approximately 60 kDa
Include positive control samples such as HeLa, U2OS, HEK-293, or Jurkat cell lysates
Consider using MIER2 knockout or knockdown samples as negative controls
Troubleshooting Considerations:
If nonspecific bands appear, increase blocking time or try different blocking reagents
If signal is weak, increase antibody concentration or extend incubation time
Following these guidelines should help researchers obtain clear, specific detection of MIER2 protein in their samples.
Successful immunohistochemistry experiments with MIER2 antibodies require careful attention to several critical factors:
Tissue Preparation and Antigen Retrieval:
Proper fixation is crucial; overfixation can mask epitopes
Heat-induced epitope retrieval (HIER) using citrate buffer (pH 6.0) or EDTA buffer (pH 9.0) is recommended
Optimization of retrieval time may be necessary for different tissue types
Antibody Selection and Dilution:
For MIER2 polyclonal antibodies, dilutions between 1:100-1:300 are typically recommended
Validated dilutions include 1:50 for human colon cancer and liver cancer tissues
Consider using recombinant antibodies for increased consistency between experiments
Controls:
Include positive control tissues with known MIER2 expression (colon cancer or liver cancer samples have been validated)
Use isotype controls to assess background staining
Consider MIER2-negative tissues as negative controls
Signal Detection and Interpretation:
Be aware that MIER2, as a transcriptional repressor, may show nuclear localization
Compare staining patterns with published results
Quantify results using appropriate scoring systems for intensity and percentage of positive cells
Multiplex Considerations:
For co-localization studies with other proteins (e.g., HDAC1), ensure antibodies are raised in different host species
Validate each antibody independently before attempting multiplex IHC
Following these guidelines will help researchers obtain reliable, interpretable IHC results when investigating MIER2 expression in tissues.
Validating antibody specificity is critical for ensuring reliable experimental results. For MIER2 antibodies, comprehensive validation should include multiple complementary approaches:
Western Blot Validation:
Confirm the presence of a single band at the expected molecular weight (~60 kDa)
Test against cell lines with known MIER2 expression (e.g., HeLa, U2OS, HEK-293, Jurkat)
Include negative controls such as MIER2 knockout cell lines or MIER2 siRNA-treated samples
Test for cross-reactivity with recombinant MIER1 and MIER3 proteins to ensure specificity within the MIER family
Immunoprecipitation:
Perform immunoprecipitation followed by mass spectrometry to confirm that MIER2 is the primary protein being pulled down
Conduct reverse immunoprecipitation with another MIER2 antibody targeting a different epitope
Immunocytochemistry/Immunofluorescence:
Confirm expected subcellular localization patterns
Compare with published localization data
Perform co-localization studies with other markers
Peptide Competition Assay:
Pre-incubate the antibody with the immunizing peptide prior to the experiment
Signal should be significantly reduced or eliminated if the antibody is specific
Orthogonal Validation:
Compare protein expression results with mRNA expression data
Validate findings using multiple antibodies targeting different epitopes of MIER2
A table summarizing recommended validation experiments:
| Validation Method | Purpose | Expected Outcome for Specific Antibody |
|---|---|---|
| Western blot | Confirm correct molecular weight | Single band at ~60 kDa |
| siRNA/CRISPR knockout | Confirm specificity | Reduced/absent signal |
| Peptide competition | Verify epitope specificity | Blocked signal |
| Cross-reactivity testing | Ensure MIER family specificity | No binding to MIER1/MIER3 |
| Multiple antibody comparison | Confirm consistency | Similar patterns with different antibodies |
By implementing these validation strategies, researchers can greatly increase confidence in their MIER2 antibody specificity and experimental results.
Western blot experiments with MIER2 antibodies may encounter several common issues. Here are the most frequent problems and their solutions:
Weak or Absent Signal:
Potential Causes: Insufficient protein loading, antibody concentration too low, short exposure time, or low MIER2 expression in sample
Solutions: Increase protein loading (40-50 μg recommended), increase antibody concentration (try 1:200 for polyclonal or 1:2000 for recombinant antibodies ), extend primary antibody incubation to overnight at 4°C, use enhanced chemiluminescence detection systems, or verify MIER2 expression in your sample type
Multiple Bands or High Background:
Potential Causes: Antibody cross-reactivity, protein degradation, insufficient blocking, or non-specific binding
Solutions: Use freshly prepared samples with protease inhibitors, increase blocking time (2 hours at room temperature), use 5% non-fat dry milk or BSA in TBS-T for blocking, optimize antibody dilution (start with manufacturer recommendations), increase washing steps (5x5 minutes), or consider using a more specific MIER2 antibody
Incorrect Molecular Weight:
Potential Causes: Post-translational modifications, splice variants, or non-specific binding
Solutions: MIER2 should appear at approximately 60 kDa ; confirm with positive control samples (HeLa cells have been validated ); if bands appear at other molecular weights, check literature for known modifications or isoforms of MIER2
Inconsistent Results:
Potential Causes: Antibody batch variation, inconsistent transfer, or variable expression
Solutions: Use recombinant antibodies for better batch-to-batch consistency , standardize your protocol (especially transfer conditions), include positive controls in each experiment, and normalize MIER2 signal to housekeeping proteins
Troubleshooting Flowchart:
No signal → Check positive control → Still no signal → Increase antibody concentration → Still no signal → Try different antibody lot/source
High background → Increase blocking → Still high background → Increase washing steps → Still high background → Decrease antibody concentration
Multiple bands → Check for degradation → Still multiple bands → Verify with another MIER2 antibody → Still multiple bands → Consider siRNA validation
Implementing these troubleshooting strategies should help resolve most common issues encountered in MIER2 Western blot experiments.
When faced with contradictory results between different MIER2 antibodies, researchers should follow a systematic approach to resolve these discrepancies:
Understanding the Source of Discrepancies:
Epitope differences: Different antibodies may target distinct epitopes on MIER2, which could be differentially accessible depending on protein conformation, interaction partners, or post-translational modifications
Antibody format variations: Polyclonal versus monoclonal or recombinant antibodies may exhibit different specificities and sensitivities
Cross-reactivity issues: Some antibodies may cross-react with other MIER family members (MIER1, MIER3) or unrelated proteins
Application-specific performance: An antibody that works well in Western blot may not perform optimally in IHC or IF applications
Methodological Approach to Resolution:
Comprehensive validation of each antibody:
Confirm target specificity using MIER2 knockout or knockdown models
Perform peptide competition assays to verify epitope-specific binding
Check for cross-reactivity with recombinant MIER1 and MIER3 proteins
Orthogonal methods validation:
Compare protein detection results with mRNA expression data (RT-PCR, RNA-seq)
Use non-antibody-based methods (e.g., mass spectrometry) to confirm protein identity and abundance
Employ tagged MIER2 constructs and detect with tag-specific antibodies
Direct antibody comparison:
Test all antibodies under identical experimental conditions
Document the epitopes targeted by each antibody and consider how protein structure might affect accessibility
Contact manufacturers for technical support and validation data
Triangulation approach:
Consider results from multiple antibodies and methods as a collective dataset
Give more weight to results confirmed by multiple independent methods
Be transparent about discrepancies in publications and presentations
When discrepancies persist:
Report all conflicting results and potential explanations in publications
Consider that different results may reflect biological reality (e.g., different isoforms or modified forms of MIER2)
Design follow-up experiments specifically to address and resolve the contradictions
Optimizing MIER2 antibody performance in challenging samples or applications requires tailored strategies to address specific difficulties:
For Samples with Low MIER2 Expression:
Implement signal amplification systems (e.g., tyramide signal amplification for IHC/IF)
Use more sensitive detection methods (e.g., enhanced chemiluminescence for Western blot)
Concentrate proteins through immunoprecipitation before Western blot analysis
Increase sample input and extend primary antibody incubation time (overnight at 4°C)
Consider using recombinant antibodies which may offer improved sensitivity
For Fixed Tissue Samples with Potential Epitope Masking:
Optimize antigen retrieval methods systematically:
Test both heat-induced epitope retrieval (HIER) and enzymatic retrieval
Compare different buffers (citrate pH 6.0, EDTA pH 9.0, Tris-EDTA)
Adjust retrieval times (10-30 minutes) and methods (microwave, pressure cooker)
Try antibodies targeting different MIER2 epitopes that may be less affected by fixation
Reduce fixation time in future samples if possible
For Complex Biological Fluids:
Pre-clear samples to remove components that may cause interference
Optimize blocking conditions using different blocking reagents (BSA, casein, commercial blockers)
Consider immunoprecipitation to isolate MIER2 before analysis
Implement additional washing steps with different buffer compositions
For Multiplex Applications:
Select MIER2 antibodies raised in different host species than other target antibodies
Validate each antibody individually before combining in multiplex formats
Use appropriate controls to assess and correct for spectral overlap in fluorescence applications
Consider sequential staining approaches for particularly challenging combinations
For Quantitative Applications:
Establish standard curves using recombinant MIER2 protein
Include appropriate internal and loading controls
Validate linearity of signal across a range of protein concentrations
Use image analysis software with appropriate background correction for quantification
For Novel Applications:
Consult literature for analogous proteins with similar characteristics to MIER2
Adapt established protocols from related nuclear or transcriptional regulator proteins
Begin with manufacturer-recommended conditions, then systematically optimize key variables
Consider computational modeling approaches to predict antibody specificity and optimal conditions
By implementing these tailored optimization strategies, researchers can enhance MIER2 antibody performance even in challenging experimental contexts, leading to more reliable and informative results.
Recent research involving MIER2 antibodies points to several promising emerging directions. Current studies highlight MIER2's role in epigenetic regulation through interaction with histone deacetylases, particularly in the context of cancer biology . This suggests that MIER2 antibodies will become increasingly important tools for investigating epigenetic mechanisms in various disease states.
An exciting development in the field involves computational modeling approaches for antibody design. Recent work has demonstrated that biophysics-informed models can disentangle multiple binding modes associated with specific ligands, enabling the prediction and generation of antibody variants with customized specificity profiles . Applied to MIER2 research, these approaches could lead to the development of next-generation antibodies with enhanced specificity, particularly for distinguishing between MIER family members.
Additionally, the identification of MIER2's role in repressing PGC1A expression by recruiting HDAC1 to deacetylate P53 in renal cell carcinoma opens new avenues for investigating MIER2 as a potential therapeutic target. This will likely drive demand for highly specific MIER2 antibodies suitable for in vivo applications and therapeutic development.