MPDU1 Antibody

Shipped with Ice Packs
In Stock

Description

Structure and Function of MPDU1 Antibody

The MPDU1 antibody is a rabbit polyclonal antibody developed by Sigma-Aldrich (catalog #HPA014845) as part of their Prestige Antibodies collection. Its specificity is directed toward the MPDU1 protein, an endoplasmic reticulum (ER) membrane protein essential for mannose-P-dolichol utilization in lipid-linked oligosaccharide (LLO) synthesis . The antibody is affinity-purified and validated for use in:

  • Immunoblotting (WB): 0.04–0.4 μg/mL

  • Immunofluorescence (ICC-IF): 0.25–2 μg/mL

  • Immunohistochemistry (IHC): 1:200–1:500 dilution .

Key Features:

  • Target Sequence: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK (UniProt accession: O75352) .

  • Reactivity: Human, mouse, rat .

  • Storage: −20°C .

Glycosylation Disorder Diagnostics

Mutations in the MPDU1 gene cause congenital disorder of glycosylation type If (CDG-If), characterized by psychomotor retardation and skin abnormalities . The antibody aids in diagnosing this condition by detecting MPDU1 protein levels via IHC or WB .

Cancer Research

The antibody has been used to study MPDU1’s role in tumor cell adhesion and glycoprotein stability. For example, in gastric cancer cell line Kato III (MPDU1-deficient), restoring MPDU1 expression increased cell-cell adhesion and corrected glycosylation defects .

ELISA Quantification

An MPDU1-specific ELISA kit (Abbkine #KTE61570) employs a sandwich assay to quantify MPDU1 levels in biological samples (plasma, serum, etc.). This kit uses a biotin-conjugated antibody and streptavidin-HRP for detection .

Cell Adhesion and Glycoprotein Stability

MPDU1 regulates cell adhesion molecules like CEACAM1. In Kato III cells, MPDU1 rescue increased CEACAM1 expression and restored normal glycosylation patterns, enhancing cell-cell interactions .

ER Stress and Glycosylation Defects

MPDU1 deficiency disrupts LLO biosynthesis, leading to truncated glycan structures (e.g., Man5GlcNAc2) . The antibody has been used to confirm these defects in both in vitro and in vivo models .

Product Specs

Buffer
**Preservative:** 0.03% Proclin 300
**Constituents:** 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Typically, we can ship your order within 1-3 business days of receipt. Delivery times may vary depending on the shipping method and destination. Please consult your local distributor for specific delivery information.
Synonyms
MPDU1; Mannose-P-dolichol utilization defect 1 protein; Suppressor of Lec15 and Lec35 glycosylation mutation homolog; SL15
Target Names
MPDU1
Uniprot No.

Target Background

Function
MPDU1 Antibody is essential for the normal utilization of mannose-dolichol phosphate (Dol-P-Man) in the synthesis of N-linked and O-linked oligosaccharides and GPI anchors.
Gene References Into Functions
  1. Research has shown that the protein levels of CEACAM-1, which plays a role in cell adhesion, are dependent on LLO biosynthesis in vivo. Kato III cells and the MPDU1-rescued Kato IIIM cells provide a novel model for examining the consequences of defective LLO biosynthesis both in vitro and in vivo. PMID: 29671116
  2. Cystinosin, MPDU1, SWEETs and KDELR belong to a well-defined protein family with a putative function of cargo receptors. PMID: 22363504
Database Links

HGNC: 7207

OMIM: 604041

KEGG: hsa:9526

STRING: 9606.ENSP00000250124

UniGene: Hs.246381

Involvement In Disease
Congenital disorder of glycosylation 1F (CDG1F)
Protein Families
MPDU1 (TC 2.A.43.3) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MPDU1 and what biological functions does it serve?

MPDU1 (Mannose-P-dolichol utilization defect 1 protein) is essential for glycosylation processes in the endoplasmic reticulum. It functions primarily in facilitating the flipping of dolichol-phosphate-mannose (DPM) and dolichol-phosphate-glucose (DPG) across the ER membrane, which is critical for their efficient utilization within the ER lumen. This process is fundamental for proper N-glycosylation and O-mannosylation pathways. MPDU1 plays a crucial role in the biosynthesis of lipid-linked oligosaccharides (LLOs), which serve as precursors for protein glycosylation. Without functional MPDU1, cells display truncated LLOs, typically corresponding to Man5GlcNac2 species rather than mature LLO structures, indicating its importance in the mannose transfer steps of LLO synthesis .

What applications are MPDU1 antibodies commonly used for?

MPDU1 antibodies are utilized across multiple research applications focused on glycosylation pathways and congenital disorders of glycosylation. Common applications include Western blotting (WB) for protein detection and quantification, immunohistochemistry (IHC) for tissue localization studies, immunofluorescence (IF) for subcellular localization, and ELISA for quantitative measurement of MPDU1 in biological samples. These antibodies are particularly valuable in studies examining glycosylation defects, ER stress responses, and membrane protein trafficking. MPDU1 antibodies produced in rabbit are among the most widely used for these applications, with polyclonal variants offering broad epitope recognition .

What sample types are suitable for MPDU1 detection using antibody-based methods?

MPDU1 can be detected in various biological samples using appropriate antibody-based techniques. Suitable sample types include serum, plasma, cell culture supernatants, and other biological fluids. For cellular studies, fibroblasts are frequently used as they express detectable levels of MPDU1 and can reveal glycosylation abnormalities. When working with tissue samples, proper fixation and antigen retrieval techniques are essential for maintaining antibody specificity. For ELISA-based detection, samples typically require dilution in the provided standard diluent to ensure measurements fall within the assay's dynamic range .

What are the known defects associated with MPDU1 dysfunction?

MPDU1 dysfunction is associated with congenital disorders of glycosylation type I (CDG-I), specifically MPDU1-CDG (formerly known as CDG-If). Clinical manifestations include developmental delay, epilepsy, psychomotor retardation, and in some cases, skin abnormalities. Recent clinical findings have expanded the phenotypic spectrum to include dystroglycanopathy characteristics such as hypotonia, elevated creatine kinase, dilated cardiomyopathy, buphthalmos, and congenital glaucoma. Additionally, some patients present with massive dilatation of the biliary duct system. At the biochemical level, MPDU1 deficiency leads to elevated disialotransferrin in serum, shortened lipid-linked oligosaccharides and DPM, and reduced O-mannosylation of alpha-dystroglycan (αDG) .

What are the optimal conditions for Western blot analysis using MPDU1 antibodies?

For optimal Western blot analysis of MPDU1, researchers should first enrich glycoproteins from fibroblast lysates using agarose-conjugated wheat germ agglutinin. Proteins should be resolved on 10% polyacrylamide gels and transferred to nitrocellulose membranes. When using rabbit polyclonal anti-MPDU1 antibodies, optimal dilutions typically range from 1:250 to 1:1000 in 5% BSA in TBST, with overnight incubation at 4°C. For detection, HRP-conjugated secondary antibodies (such as goat anti-rabbit) should be used at approximately 1:5000 dilution, followed by enhanced chemiluminescence detection. Due to MPDU1's involvement in glycosylation, detected bands may appear at varying molecular weights depending on the glycosylation status in different sample types or disease states .

How can MPDU1 antibodies be used to investigate glycosylation defects?

MPDU1 antibodies serve as powerful tools for investigating glycosylation defects through multiple approaches. One effective method involves coupling MPDU1 immunodetection with lectin analysis to assess altered glycosylation patterns. Researchers can compare glycoprotein profiles between wild-type cells and those with MPDU1 mutations using lectin binding assays with concanavalin A (ConA) and phytohemagglutinin (PHA) in the presence of glycosylation inhibitors like swainsonine. Additionally, MPDU1 antibodies can be used in immunoprecipitation followed by mass spectrometry to identify interacting partners within the glycosylation machinery. For in vivo studies, immunohistochemistry using MPDU1 antibodies can reveal altered subcellular localization patterns associated with glycosylation defects .

What controls should be included when using MPDU1 antibodies in experimental protocols?

Rigorous experimental design for MPDU1 antibody applications should include multiple controls. Positive controls should incorporate cell lines known to express MPDU1, such as wild-type fibroblasts. For negative controls, MPDU1-deficient cell lines (like Kato III) provide an excellent reference point. When available, MPDU1-rescued cell lines (such as Kato IIIM) offer an isogenic control system demonstrating restored MPDU1 function. For immunohistochemistry, calnexin can serve as an unchanged control protein, as demonstrated in xenograft studies. Additionally, when studying MPDU1 in the context of congenital disorders of glycosylation, including controls for other glycosylation pathway proteins (such as components of the ALG family) helps discriminate between MPDU1-specific effects and broader glycosylation disruptions .

How can researchers validate MPDU1 antibody specificity?

Validating MPDU1 antibody specificity requires a multi-faceted approach. Initially, researchers should perform Western blot analysis comparing samples with known MPDU1 expression levels, including MPDU1-deficient cell lines (like Kato III) and genetically rescued variants. Peptide competition assays, where the antibody is pre-incubated with the immunizing peptide, can confirm binding specificity. For further validation, genetic approaches using MPDU1 knockout/knockdown models through CRISPR-Cas9 or siRNA techniques provide definitive controls. Importantly, researchers should verify antibody specificity across different applications (WB, IHC, IF) as performance may vary between techniques. Cross-reactivity testing against similar proteins in the glycosylation pathway is also advisable to ensure signal specificity .

How can MPDU1 antibodies be used to investigate cell adhesion phenotypes?

MPDU1 antibodies can be instrumental in investigating the connection between glycosylation and cell adhesion phenotypes. Research has demonstrated that MPDU1 restoration in deficient cell lines increases cell-cell adhesion both in vitro and in vivo. To study this phenomenon, researchers should employ immunofluorescence microscopy using MPDU1 antibodies in conjunction with antibodies against adhesion molecules like CEACAM1, which is known to be regulated by MPDU1 expression. Three-dimensional cell culture models can help visualize altered growth patterns, with quantification of aggregate formation and size. For in vivo validation, xenograft tumor models comparing MPDU1-deficient and MPDU1-rescued cells, followed by immunohistochemical analysis, can reveal changes in glandular structure organization resulting from altered cell-cell adhesion properties .

What approaches can be used to study the relationship between MPDU1 and alpha-dystroglycan glycosylation?

Investigating the relationship between MPDU1 and alpha-dystroglycan (αDG) glycosylation requires specialized techniques. Researchers should begin with wheat germ agglutinin enrichment of glycoproteins from patient fibroblasts or model cell lines, followed by Western blotting using both anti-MPDU1 antibodies and antibodies against glycosylated αDG (IIH6C4) and the dystroglycan core protein. Laminin overlay assays can assess αDG functional glycosylation, as properly glycosylated αDG binds laminin. Flow cytometry using αDG glycosylation-specific antibodies can quantify glycosylation levels in MPDU1-deficient versus control cells. For comprehensive analysis, researchers should complement protein-level studies with analysis of O-mannosylation pathway genes using qRT-PCR to identify potential compensatory mechanisms activated in response to MPDU1 deficiency .

How can transcriptomic and proteomic approaches be integrated with MPDU1 antibody studies?

Integrating transcriptomic and proteomic approaches with MPDU1 antibody studies provides a comprehensive understanding of MPDU1 function. Expression microarray analysis comparing MPDU1-deficient and MPDU1-rescued cells can identify differentially expressed genes, particularly those involved in ER function and plasma membrane composition. Proteome antibody arrays can simultaneously detect changes in multiple proteins, including membrane proteins like ADAM-15 and CEACAM1. Researchers should validate key findings through Western blotting or immunohistochemistry using specific antibodies, including anti-MPDU1. For deeper mechanistic insights, chromatin immunoprecipitation followed by sequencing (ChIP-seq) can identify transcription factors mediating MPDU1-dependent gene expression changes. Importantly, in vivo validation of in vitro findings using xenograft models with subsequent immunohistochemical analysis ensures physiological relevance .

What are the considerations for using MPDU1 antibodies in studies of congenital disorders of glycosylation?

When using MPDU1 antibodies to study congenital disorders of glycosylation (CDG), researchers must consider several critical factors. Patient-derived fibroblasts offer an excellent model system, but researchers should confirm MPDU1 mutations through genetic analysis before antibody-based studies. Biochemical characterization should include serum transferrin isoelectric focusing (TIEF) and electrospray ionization mass spectrometry (ESI-MS) to confirm CDG-I abnormalities. For comprehensive analysis, antibodies against multiple glycosylation pathway components should be employed alongside MPDU1 antibodies. When comparing MPDU1-CDG to other CDG subtypes, researchers should analyze LLO profiles using HPLC and TLC techniques. Importantly, informed consent must be obtained for studies involving patient samples, in accordance with the Declaration of Helsinki, and identifying information should be properly anonymized in research publications .

What factors may affect MPDU1 antibody performance in Western blotting?

Several factors can influence MPDU1 antibody performance in Western blotting. Glycosylation heterogeneity of MPDU1 itself may cause band shifts or multiple bands, necessitating deglycosylation treatments (PNGase F) before SDS-PAGE for clearer results. Sample preparation is critical; excessive heating can cause protein aggregation, while insufficient lysis may result in poor protein extraction. For membrane proteins like MPDU1, detergent selection is crucial—RIPA buffer with 0.1% SDS typically provides good extraction efficiency. Blocking solutions containing glycoproteins (like milk) may interfere with glycosylation-dependent epitopes, making BSA a preferable blocking agent. When transferring to membranes, PVDF may retain MPDU1 better than nitrocellulose for some antibody clones. Finally, primary antibody concentration and incubation time should be optimized through titration experiments, typically starting with dilutions between 1:250 and 1:1000 .

How can cross-reactivity issues with MPDU1 antibodies be addressed?

Addressing cross-reactivity issues with MPDU1 antibodies requires systematic troubleshooting. First, researchers should verify antibody specificity using MPDU1-deficient cells (such as Kato III) as negative controls. If cross-reactivity persists, antibody purification through affinity techniques using the immunizing peptide can improve specificity. Alternative antibody clones recognizing different MPDU1 epitopes should be tested, as certain epitopes may share homology with other proteins. For applications like immunofluorescence and immunohistochemistry, more stringent washing conditions and reduced primary antibody concentrations may help minimize non-specific binding. In multiplex staining protocols, careful antibody selection from different host species and use of highly cross-adsorbed secondary antibodies can prevent cross-reactivity between detection systems. Finally, validation across multiple techniques provides confidence in the specificity of observed signals .

What are the optimal conditions for MPDU1 ELISA assays?

For optimal MPDU1 ELISA assays, several technical parameters must be carefully controlled. MPDU1 ELISA kits utilize a sandwich format with pre-coated antibodies specific for MPDU1. Sample preparation is critical; serum and plasma samples typically require a 2-10 fold dilution in the provided standard diluent, while cell culture supernatants may be used undiluted or with minimal dilution. Standard curves should be prepared fresh for each assay using serial dilutions of the provided MPDU1 standard. Incubation times must be strictly followed—typically 2 hours for samples and standards, 1 hour for detection antibody, and 30 minutes for streptavidin-HRP conjugate, all at room temperature. Washing steps are crucial for assay performance, with 5 washes recommended between each step using the provided wash buffer. For optimal color development, the substrate should be allowed to react for 15-20 minutes protected from light before adding stop solution. Absorbance should be read at 450 nm with a secondary wavelength of 620 nm for background subtraction .

How should researchers interpret varying results across different MPDU1 antibody applications?

When faced with varying results across different MPDU1 antibody applications, researchers should consider application-specific factors that influence antibody performance. Western blotting primarily detects denatured proteins, making it suitable for linear epitopes but potentially missing conformational epitopes preserved in techniques like ELISA or immunofluorescence. For immunohistochemistry, fixation methods significantly impact epitope accessibility—paraformaldehyde fixation may preserve some epitopes better than alcohol-based fixatives. When using the same antibody across multiple techniques, optimization is necessary for each application; a dilution that works for Western blotting (1:1000) might be insufficient for immunofluorescence (which might require 1:250). Batch-to-batch variations in polyclonal antibodies may also contribute to inconsistent results, necessitating careful lot tracking. When possible, researchers should validate findings using multiple MPDU1 antibody clones targeting different epitopes and correlate antibody-based results with functional assays like lectin sensitivity tests or LLO profiling .

How can MPDU1 antibodies contribute to understanding the link between glycosylation and cancer progression?

MPDU1 antibodies offer valuable tools for investigating the connection between glycosylation defects and cancer biology. The Kato III gastric carcinoma cell line model, which naturally lacks MPDU1, provides an excellent system for studying how glycosylation affects tumor properties. Researchers can perform immunohistochemistry on cancer tissue microarrays using MPDU1 antibodies to correlate expression levels with clinical outcomes. Studies comparing xenograft tumors derived from MPDU1-deficient and MPDU1-rescued cells have demonstrated that MPDU1 restoration affects tumor organization through increased cell-cell adhesion. This suggests potential tumor-suppressive roles for proper glycosylation. Multi-parameter flow cytometry using MPDU1 antibodies alongside markers for epithelial-mesenchymal transition can help elucidate mechanisms by which glycosylation affects invasiveness. Furthermore, immunoprecipitation followed by mass spectrometry can identify cancer-specific MPDU1 interactors that might represent novel therapeutic targets .

What potential exists for MPDU1 antibodies in therapeutic development for congenital disorders of glycosylation?

While MPDU1 antibodies primarily serve as research tools, they hold potential for therapeutic development pathways for congenital disorders of glycosylation (CDG). In diagnostic applications, MPDU1 antibodies can help characterize patient-specific defects through immunofluorescence assessment of MPDU1 subcellular localization, particularly for mutations that affect trafficking rather than expression. For therapeutic development, antibodies can facilitate high-throughput screening assays to identify small molecules that stabilize mutant MPDU1 or enhance residual activity. Therapeutic strategies might include targeted delivery of functional MPDU1 using nanoparticles, where antibodies could help assess delivery efficiency. Additionally, gene therapy approaches for MPDU1-CDG would benefit from antibody-based validation of protein expression following gene delivery. For personalized medicine applications, patient-derived cells treated with potential therapeutics can be analyzed using MPDU1 antibodies to predict individual treatment responses .

How might advanced microscopy techniques enhance MPDU1 antibody-based research?

Advanced microscopy techniques can significantly enhance MPDU1 antibody-based research by providing unprecedented spatial and temporal resolution. Super-resolution microscopy methods such as STORM or PALM using fluorophore-conjugated MPDU1 antibodies can reveal the precise nanoscale organization of MPDU1 within the ER membrane, potentially identifying specific microdomains critical for function. Live-cell imaging with genetically encoded MPDU1 fusion proteins, validated against antibody staining patterns, can track dynamic changes in MPDU1 localization during glycosylation stress responses. For tissue-level studies, expansion microscopy combined with MPDU1 immunolabeling can visualize subcellular distribution in complex tissues while maintaining spatial relationships. Correlative light and electron microscopy (CLEM) using gold-conjugated MPDU1 antibodies allows researchers to correlate fluorescence patterns with ultrastructural features of the ER. Finally, multiplexed ion beam imaging (MIBI) can simultaneously detect dozens of proteins, including MPDU1 and its interactors, providing comprehensive spatial proteomics data in tissues from CDG patients .

What is the potential for using MPDU1 antibodies in high-throughput screening applications?

MPDU1 antibodies present significant potential for high-throughput screening (HTS) applications in glycobiology research and drug discovery. Researchers can develop cell-based assays using fluorescently labeled MPDU1 antibodies to screen for compounds that rescue mutant MPDU1 trafficking or stability in patient-derived cells. For functional screens, MPDU1 antibodies can be combined with lectins in multiplexed flow cytometry assays to simultaneously assess MPDU1 expression and glycosylation patterns across thousands of conditions. Automated microscopy platforms using MPDU1 immunofluorescence can evaluate compound libraries for agents that modulate MPDU1 localization or expression. In CRISPR-Cas9 genetic screens, MPDU1 antibodies can help identify genes affecting MPDU1 function or glycosylation more broadly. For translational applications, high-content screening platforms using MPDU1 and glycosylation marker antibodies can assess patient-derived cells for personalized therapeutic strategies. These HTS approaches require careful validation of antibody specificity and optimization of detection parameters to ensure reliable, reproducible results across large sample sets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.