MRS2-8 Antibody

What is MRS2 and why is it significant in cellular research?

MRS2 (Mitochondrial RNA Splicing 2) is an integral mitochondrial inner membrane protein that functions as a magnesium transporter, mediating the influx of Mg²⁺ into the mitochondrial matrix. It is distantly related to the bacterial CorA family of Mg²⁺ transporters and is required for mitochondrial respiratory chain complex I function . Its significance stems from its critical role in maintaining mitochondrial magnesium homeostasis, which affects numerous biological processes including ATP production, protein stabilization, and enzymatic activities. MRS2 was initially identified for its requirement in mitochondrial RNA group II intron splicing in yeast, which is now understood to be an indirect effect of its role in providing adequate magnesium levels to stabilize functional ribozyme structures . Recent research has revealed that MRS2 exists in both N-glycosylated and non-glycosylated states in mammalian mitochondria, with the glycosylation status affecting mitochondrial magnesium influx capacity .

What epitopes do commercially available MRS2 antibodies typically target?

Commercial MRS2 antibodies are developed against various epitopes of the protein. For example, the Novus Biologicals MRS2 Polyclonal Antibody is developed against a recombinant protein corresponding to specific amino acids: "NTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFI" . Another antibody available from antibodies-online targets amino acids 201-300 of the MRS2 protein . When selecting an MRS2 antibody for your research, it's important to consider which domain of MRS2 you wish to study. For investigations focused on the magnesium-binding domain or N-glycosylation sites, ensure that the antibody's epitope includes or allows visualization of these regions.

How does MRS2 structure relate to its function as a magnesium transporter?

MRS2 contains two transmembrane domains that constitute a pore in the inner mitochondrial membrane, while most of the protein resides within the mitochondrial matrix as an amino terminal domain (NTD) . This structure is critical to its function as a magnesium channel. Unlike its bacterial ortholog CorA, which forms a pentameric assembly, the human MRS2 NTD self-associates into a homodimer . The NTD plays a crucial regulatory role through a negative feedback mechanism: Mg²⁺ binding to the NTD suppresses higher-order oligomerization and influences channel activity. Research has shown that mutations affecting Mg²⁺ binding to the NTD decrease binding affinity approximately sevenfold and abrogate Mg²⁺-induced changes in secondary, tertiary, and quaternary structures . Interestingly, disruption of NTD Mg²⁺ binding potentiates mitochondrial Mg²⁺ uptake, revealing an autoregulatory mechanism where the NTD serves as a sensor for matrix Mg²⁺ levels and regulates channel activity accordingly .

What are the optimal applications and dilutions for MRS2 antibodies in different experimental techniques?

MRS2 antibodies can be utilized in multiple experimental techniques with different optimal dilutions:

When working with MRS2 antibodies, it's crucial to optimize conditions for your specific sample type. For detecting both N-glycosylated and non-glycosylated isoforms of MRS2 in Western blot applications, ensure your gel system can resolve these two forms which appear as distinct bands with different molecular weights . Additionally, consider validating antibody specificity using appropriate controls, such as MRS2 knockout samples or peptide competition assays.

How can I effectively detect both glycosylated and non-glycosylated forms of MRS2?

To effectively detect both glycosylated and non-glycosylated forms of MRS2:

• Sample preparation: Isolate mitochondria using established protocols to ensure enrichment of mitochondrial proteins. Both MRS2 isoforms have been consistently detected in mitochondria isolated from mouse liver, rat and mouse liver fibroblast cells (BRL 3A and AFT024), and human skin fibroblasts .

• SDS-PAGE conditions: Use a gel percentage that allows clear separation of the higher molecular weight (glycosylated) and lower molecular weight (non-glycosylated) MRS2 isoforms.

• Validation of glycosylation: To confirm that the higher molecular weight band is indeed N-glycosylated MRS2, treat samples with PNGase F (peptide: N-glycosidase F), which should cause the higher Mr band to gel-shift to a lower Mr position .

• Alternative validation: Treat cells with N-linked glycosylation inhibitors such as tunicamycin or 6-diazo-5-oxo-l-norleucine before isolation of mitochondria. This treatment should decrease the intensity or completely eliminate the higher Mr MRS2 isoform .

• Lectin affinity assays: To further confirm N-glycosylation, perform lectin affinity chromatography using columns with covalently bound concanavalin A or Lens culinaris agglutinin. The N-glycosylated MRS2 will bind to these columns and require stringent elution conditions .

These approaches will help you reliably distinguish between the glycosylated and non-glycosylated forms of MRS2 and validate your findings through multiple complementary methods.

What controls should be included when using MRS2 antibodies for immunological detection?

When using MRS2 antibodies for immunological detection, include the following controls:

• Positive control: Use samples known to express MRS2, such as isolated mitochondria from liver tissue or liver-derived cell lines like BRL 3A, which have been documented to express both glycosylated and non-glycosylated MRS2 isoforms .

• Negative control: Include Mrs2 knockout cells or tissues when available . If knockout samples are not available, use tissues or cells known to express very low levels of MRS2.

• Loading control: Include antibodies against established mitochondrial markers (e.g., VDAC, COX IV) to confirm equal loading of mitochondrial proteins and to verify the purity of your mitochondrial preparation.

• Peptide competition assay: Pre-incubate the MRS2 antibody with the immunizing peptide to confirm specificity. This should eliminate or significantly reduce the specific signal.

• Isotype control: Use an irrelevant antibody of the same isotype (e.g., rabbit IgG for rabbit polyclonal MRS2 antibodies) to identify potential non-specific binding .

• Cross-reactivity validation: If working with non-human samples, verify the antibody's cross-reactivity with your species of interest. Available MRS2 antibodies have documented reactivity with human, mouse, and rat proteins, with predicted reactivity to other mammals .

Including these controls will help validate the specificity of your MRS2 antibody and strengthen the reliability of your experimental findings.

How does cellular energy status affect MRS2 glycosylation and function?

Research has revealed a fascinating relationship between cellular energy metabolism and MRS2 glycosylation status, which in turn affects mitochondrial magnesium influx capacity. The fraction of N-glycosylated MRS2 correlates with the relative contributions of oxidative phosphorylation (OXPHOS) and glycolysis to cellular energy demand .

When cells rely more on glycolysis (glucose abundance):

• Increased fraction of N-glycosylated MRS2

• Decreased mitochondrial Mg²⁺ influx capacity

When cells are forced to rely on mitochondrial respiration:

• Reduced N-glycosylated MRS2 isoform

• Increased mitochondrial Mg²⁺ influx capacity

This relationship has been demonstrated through several experimental approaches:

• Treatment with galactose media (which forces cells to rely on OXPHOS)

• Treatment with glycolytic inhibitors like 2-deoxyglucose

• Minimizing glucose concentration

All these conditions reduced the N-glycosylated isoform of MRS2 and increased rapid Mg²⁺ influx capacity .

Conversely, inhibiting mitochondrial energy production with respiratory chain inhibitors like rotenone (complex I inhibitor) or oligomycin (ATP synthase inhibitor) increased the fraction of N-glycosylated MRS2 and decreased rapid Mg²⁺ influx capacity .

These findings suggest that MRS2 N-glycosylation serves as a dynamic communication mechanism, reflecting cellular nutrient status and bioenergetic capacity by regulating mitochondrial matrix Mg²⁺ influx under conditions of glucose excess or mitochondrial bioenergetic impairment . When designing experiments to study MRS2 glycosylation, researchers should carefully consider and control the metabolic conditions of their experimental system.

What is the relationship between MRS2 and mitochondrial respiratory chain diseases?

The relationship between MRS2 and mitochondrial respiratory chain (RC) diseases is an emerging area of research. Studies have observed that the N-glycosylated MRS2 isoform is increased in several mitochondrial RC disease patient fibroblast cell lines (FCLs) . This observation suggests that alterations in MRS2 glycosylation status may be part of the cellular response to mitochondrial dysfunction.

MRS2 has been shown to be required for mitochondrial RC complex I function , suggesting a direct functional relationship between MRS2-mediated magnesium transport and respiratory chain activity. Since proper magnesium homeostasis is essential for numerous mitochondrial functions, including maintenance of membrane potential and ATP synthesis, dysregulation of MRS2 function could contribute to or exacerbate mitochondrial disease pathology.

When investigating the role of MRS2 in mitochondrial diseases, researchers should consider:

• Analyzing MRS2 glycosylation status in patient-derived samples

• Measuring mitochondrial magnesium levels and influx capacity in disease models

• Assessing whether modulation of MRS2 activity (e.g., through expression of the non-glycosylatable mutant) affects disease phenotypes

• Exploring potential therapeutic approaches targeting MRS2-mediated magnesium transport

These investigations could provide valuable insights into the pathophysiology of mitochondrial diseases and potentially identify novel therapeutic targets.

How does MRS2 NTD dimer formation differ from bacterial CorA pentamers, and what are the functional implications?

The structural organization of MRS2 differs significantly from its bacterial ortholog CorA, with important functional implications. While bacterial CorA forms a pentameric assembly, the human MRS2 amino terminal domain (NTD) self-associates into a homodimer . This structural difference reflects an evolutionary divergence in magnesium channel regulation between prokaryotes and eukaryotes.

Key differences and their functional implications include:

• Oligomeric state: The MRS2 NTD homodimer structure contrasts with the pentameric assembly of CorA. This difference suggests unique mechanisms of channel gating and regulation in the eukaryotic system .

• Magnesium sensing: Both MRS2 and CorA bind Mg²⁺, but their responses differ. In MRS2, Mg²⁺ and calcium suppress lower and higher order oligomerization of the NTD, while cobalt has no effect on the NTD but disassembles full-length MRS2 . This selective response to different divalent cations suggests a sophisticated regulation mechanism.

• Channel autoregulation: The MRS2 NTD serves as a regulatory domain that provides negative feedback control. Disruption of NTD Mg²⁺ binding potentiates mitochondrial Mg²⁺ uptake in both wild-type and Mrs2 knockout cells, indicating that the NTD acts as a regulatory brake on channel activity .

• Gain-of-function mutations: Research has identified mutations that disrupt Mg²⁺ binding to the NTD while preserving protein structure. These mutations create gain-of-function channels with enhanced Mg²⁺ transport capacity , providing valuable tools for studying MRS2 function and potentially for therapeutic applications.

When studying MRS2 structure-function relationships, researchers should consider these unique features of the eukaryotic magnesium channel and design experiments that account for the regulatory role of the NTD dimer.

Why might I detect multiple bands when using MRS2 antibodies in Western blot analysis?

Detection of multiple bands when using MRS2 antibodies in Western blot analysis can occur for several reasons:

• Glycosylation heterogeneity: MRS2 exists in both N-glycosylated and non-glycosylated forms. The glycosylated isoform has a higher molecular weight and appears as a distinct band above the non-glycosylated form . This is a legitimate pattern reflecting the biological state of the protein.

• Proteolytic degradation: Incomplete protease inhibition during sample preparation can result in partial degradation of MRS2, generating fragments that appear as lower molecular weight bands. Ensure complete protease inhibitor cocktails are used during sample preparation.

• Nonspecific binding: Some antibodies may cross-react with proteins that share epitope similarity with MRS2. To address this:

  • Use higher dilutions of the primary antibody

  • Increase washing stringency

  • Perform peptide competition assays to identify specific bands

  • Consider using alternative MRS2 antibodies targeting different epitopes

• Post-translational modifications: Beyond N-glycosylation, MRS2 may undergo other post-translational modifications that alter its molecular weight or electrophoretic mobility.

• Alternative splicing: Though not specifically documented for MRS2 in the provided search results, alternative splicing can generate protein isoforms of different sizes.

To confirm which bands represent authentic MRS2:

• Compare patterns with positive control samples known to express MRS2

• Validate glycosylated forms using PNGase F treatment, which should convert the higher Mr band to the lower Mr form

• Use cells treated with glycosylation inhibitors like tunicamycin as additional controls

• If available, include samples from MRS2 knockout models as negative controls

How can I assess antibody specificity for MRS2 in my experimental system?

Assessing antibody specificity for MRS2 in your experimental system is crucial for generating reliable data. Here are comprehensive methods to validate specificity:

• Genetic validation approaches:

  • Use MRS2 knockout or knockdown models (cells or tissues) as negative controls

  • Compare staining patterns between wild-type and knockout/knockdown samples

  • Perform rescue experiments by reintroducing MRS2 expression in knockout cells

• Biochemical validation approaches:

  • Peptide competition assays: Pre-incubate the antibody with the immunizing peptide before application

  • Use multiple antibodies targeting different epitopes of MRS2 and compare staining patterns

  • For antibodies against recombinant proteins, perform selective immunoprecipitation followed by mass spectrometry to confirm target identity

• Validated antibody selection:

  • Prioritize antibodies verified on protein arrays against target protein plus other non-specific proteins

  • Review published literature for antibodies with documented specificity testing

  • Consider antibodies validated in the Human Protein Atlas project, which includes extensive validation protocols

• Subcellular localization confirmation:

  • Verify that the detected signal localizes primarily to mitochondria

  • Perform co-localization studies with established mitochondrial markers

  • Confirm the staining pattern matches MRS2's expected submitochondrial localization (inner membrane)

• Functional validation:

  • Correlate antibody staining intensity with functional assays of MRS2 activity (e.g., mitochondrial Mg²⁺ uptake)

  • Assess whether experimental conditions known to affect MRS2 (e.g., glycosylation inhibitors) produce expected changes in antibody-detected signals

By combining multiple validation approaches, you can establish high confidence in the specificity of your MRS2 antibody and strengthen the reliability of your experimental findings.

What experimental approaches can confirm that MRS2 glycosylation affects magnesium transport?

To confirm that MRS2 glycosylation directly affects magnesium transport function, multiple complementary experimental approaches should be employed:

• Pharmacological inhibition of glycosylation:

  • Treat cells with N-linked glycosylation inhibitors (tunicamycin or 6-diazo-5-oxo-l-norleucine)

  • Isolate mitochondria and measure rapid Mg²⁺ influx capacity

  • Confirm reduction of glycosylated MRS2 isoform by Western blot

  • Research has shown that such treatment increases mitochondrial Mg²⁺ influx capacity

• Site-directed mutagenesis:

  • Identify N-glycosylation sites in MRS2 (typically asparagine residues in N-X-S/T motifs)

  • Generate MRS2 mutants with these sites altered to prevent glycosylation

  • Express wild-type and mutant MRS2 in MRS2-knockout cells

  • Compare Mg²⁺ transport activity between wild-type and non-glycosylatable MRS2

• Metabolic manipulation:

  • Culture cells under conditions that alter the glycosylation/non-glycosylation ratio:

    • Galactose media (forces reliance on mitochondrial respiration)

    • Glycolytic inhibitors (2-deoxyglucose)

    • Minimal glucose concentration

    • Mitochondrial inhibitors (rotenone, oligomycin)

  • Correlate changes in glycosylation status with Mg²⁺ transport capacity

• Direct measurement of MRS2 channel activity:

  • Perform electrophysiological measurements of MRS2 channel activity in reconstituted systems

  • Compare conductance properties of glycosylated versus deglycosylated forms

• In vivo confirmation:

  • Generate animal models expressing non-glycosylatable MRS2

  • Assess mitochondrial function, Mg²⁺ homeostasis, and physiological consequences

• Structural studies:

  • Use techniques like cryogenic electron microscopy to determine how glycosylation affects MRS2 structure

  • Correlate structural changes with functional alterations in Mg²⁺ transport

These approaches collectively would provide strong evidence for a direct functional relationship between MRS2 glycosylation status and its magnesium transport activity, as suggested by current research .

How might targeting MRS2 glycosylation be relevant for mitochondrial disease therapies?

Targeting MRS2 glycosylation presents an intriguing therapeutic avenue for mitochondrial diseases, based on several key observations:

• Increased N-glycosylated MRS2 has been observed in mitochondrial respiratory chain disease patient fibroblasts , suggesting a potential role in disease pathophysiology.

• N-glycosylated MRS2 acts as a "physiologic brake" on mitochondrial magnesium influx, particularly under conditions of glucose excess or mitochondrial dysfunction . Reducing this glycosylation could potentially enhance mitochondrial magnesium availability.

• Enhanced mitochondrial magnesium uptake through manipulation of MRS2 glycosylation might improve mitochondrial function in disease states by:

  • Supporting ATP production

  • Enhancing mitochondrial protein synthesis and stability

  • Improving electron transport chain efficiency

  • Reducing oxidative stress

Potential therapeutic approaches could include:

• Development of small molecules that selectively inhibit MRS2 glycosylation without affecting global cellular glycosylation

• Gene therapy approaches delivering non-glycosylatable MRS2 variants that maintain channel function but escape glycosylation-mediated inhibition

• Identification of the specific glycosyltransferases responsible for MRS2 modification, which could serve as more selective drug targets

• Metabolic interventions that naturally reduce MRS2 glycosylation, such as ketogenic diets or compounds that shift cellular metabolism toward oxidative phosphorylation

Before clinical translation, research should address several questions:

• Is enhanced magnesium influx beneficial or potentially harmful in specific mitochondrial diseases?

• What are the long-term consequences of altering MRS2 glycosylation?

• How does the therapeutic window for enhancing mitochondrial magnesium uptake vary across different mitochondrial disorders?

These investigations could lead to novel therapeutic strategies for mitochondrial diseases, for which treatment options remain limited.

What techniques are emerging for studying MRS2 structure-function relationships?

Emerging techniques for studying MRS2 structure-function relationships are advancing our understanding of this important mitochondrial magnesium transporter:

• Cryo-electron microscopy (cryo-EM):

  • Allows visualization of MRS2 in its native conformation

  • Can reveal conformational changes induced by magnesium binding

  • Particularly valuable for comparing glycosylated and non-glycosylated forms

  • Could clarify how the homodimeric NTD structure regulates channel activity

• CRISPR-Cas9 genome editing:

  • Creation of precise mutations to study specific residues involved in Mg²⁺ binding

  • Generation of glycosylation site mutants to study the effect on channel function

  • Development of endogenously tagged MRS2 for live-cell imaging and functional studies

• Advanced protein-protein interaction studies:

  • Proximity labeling techniques (BioID, APEX) to identify MRS2 interaction partners in the mitochondrial inner membrane

  • Förster resonance energy transfer (FRET) to study conformational changes upon ligand binding

  • Single-molecule imaging to analyze channel dynamics

• Mitochondrial patch-clamp techniques:

  • Direct measurement of MRS2 channel activity in isolated mitochondria

  • Assessment of channel kinetics under different physiological conditions

  • Evaluation of how glycosylation affects channel gating properties

• Real-time magnesium imaging:

  • Targeted mitochondrial magnesium sensors

  • High-resolution imaging to track Mg²⁺ flux in response to metabolic changes

  • Correlation of Mg²⁺ dynamics with MRS2 modification status

• Computational approaches:

  • Molecular dynamics simulations to predict how glycosylation affects channel function

  • Machine learning algorithms to identify patterns in MRS2 regulation across different cellular states

  • Systems biology approaches to integrate MRS2 function into broader mitochondrial regulatory networks

These emerging techniques promise to provide unprecedented insights into how MRS2 structure, particularly the regulatory role of its NTD and its glycosylation status, determines its function in mitochondrial magnesium homeostasis. Such understanding could lead to novel therapeutic approaches for mitochondrial disorders.

How does MRS2-mediated magnesium transport integrate with calcium signaling in mitochondria?

The integration of MRS2-mediated magnesium transport with calcium signaling in mitochondria represents a complex interplay between two essential divalent cations:

• Competitive binding interactions:

  • Mg²⁺ and Ca²⁺ compete for binding sites on proteins and membranes

  • This competition can significantly influence intracellular Ca²⁺ dynamics and signaling

  • MRS2-regulated mitochondrial Mg²⁺ levels may thus indirectly modulate Ca²⁺-dependent processes

• Regulatory cross-talk:

  • Research shows that calcium ions, like magnesium, can suppress oligomerization of the MRS2 NTD

  • This suggests that mitochondrial Ca²⁺ fluctuations may directly regulate MRS2 channel activity

  • Such regulation could represent a feedback mechanism coordinating the two ion systems

• Impact on mitochondrial membrane potential:

  • Both Mg²⁺ and Ca²⁺ influence mitochondrial membrane potential

  • Proper Mg²⁺ homeostasis maintained by MRS2 is essential for maintaining membrane potential

  • Altered membrane potential affects mitochondrial Ca²⁺ uptake through the mitochondrial calcium uniporter (MCU)

• Bioenergetic coordination:

  • Ca²⁺ is a key activator of several TCA cycle enzymes and enhances ATP production

  • Mg²⁺ is required for many ATP-dependent processes and forms biologically functional Mg²⁺-ATP complexes

  • The coordination between these ions may optimize mitochondrial energy production

• Pathological implications:

  • Dysregulation of either ion system can contribute to mitochondrial dysfunction

  • In disease states, altered MRS2 function may impact Ca²⁺ handling and vice versa

  • Understanding this interplay could provide insights into mitochondrial pathologies

To investigate this relationship, researchers could:

• Develop dual-sensor systems to simultaneously monitor mitochondrial Mg²⁺ and Ca²⁺ fluctuations

• Assess how MRS2 mutations or glycosylation status affects mitochondrial Ca²⁺ uptake and buffering

• Examine whether interventions targeting mitochondrial Ca²⁺ homeostasis influence MRS2 function

This research direction could uncover important mechanisms in mitochondrial ion homeostasis with implications for cellular bioenergetics, signaling, and disease processes.