MTDH Antibody

What is MTDH and why is it significant in cancer research?

MTDH is a protein encoded by the MTDH gene (Gene ID: 92140) with a calculated molecular weight of 64 kDa (582 amino acids), though typically observed at 65-70 kDa in Western blots . It plays critical roles in:

• Promoting metastasis to lung, bone, and brain tissues

• Conferring resistance to chemotherapeutic agents including 5-fluorouracil, doxorubicin, paclitaxel, and cisplatin

• Activating multiple oncogenic signaling pathways (Ras, Myc, PI3K/AKT, NF-κB, MAPK, and Wnt)

MTDH's overexpression has been documented in nearly all solid tumors examined, including breast, prostate, gastric, renal, colorectal, ovarian, and endometrial cancers, making it a significant target for cancer research and potential therapeutic interventions .

What cellular localization patterns does MTDH exhibit?

MTDH localizes to multiple cellular compartments with distinct functions:

• Cytoplasmic MTDH: Predominant in many cancer types, associates with RNA and RNA-binding proteins, blocks Rad51 nuclear accumulation, and increases survival and drug resistance

• Nuclear MTDH: Acts as a transcription co-factor to induce expression of chemoresistance-associated genes

• Plasma membrane MTDH: Involved in metastasis-related functions

Importantly, cytoplasmic localization in prostate tumors correlates with poor prognosis, suggesting compartment-specific functions relevant to cancer progression .

What validated applications exist for MTDH antibodies?

The following applications have been validated with supporting literature:

How should I optimize MTDH antibody use for immunohistochemistry?

For optimal IHC results with MTDH antibodies:

• Antigen retrieval: Use TE buffer pH 9.0 as the primary method; citrate buffer pH 6.0 can be used as an alternative

• Validated tissues: Human breast cancer tissue, mouse brain tissue, and human liver cancer tissue have shown positive results

• Dilution optimization: Begin with 1:200-1:800 dilution range and optimize based on signal-to-noise ratio

• Detection system: Anti-Sheep HRP-DAB has been validated for certain antibodies

• Expected pattern: Cytoplasmic and/or nuclear staining depending on cancer type

Critically, MTDH staining patterns may vary by cancer type, with cytoplasmic predominance in some cancers (endometrial cancer cells) and mixed localization in others .

MTDH's function as an RNA-binding protein can be investigated using RNA-IP (RIP) protocols:

• Prepare cell lysates from your cell line of interest (e.g., Hec50 cells as in published research)

• Immunoprecipitate MTDH using validated antibodies (consider using FLAG-tagged MTDH constructs for specificity)

• Extract RNA from the immunoprecipitated complexes

• Analyze associated RNAs via:

  • RIP-chip microarray analysis (as demonstrated in research where MTDH-associated RNAs were identified)

  • RT-PCR for specific target validation

  • RNA sequencing for comprehensive profiling

Control experiments should include:

• IgG control immunoprecipitation

• Input RNA samples

• Nuclease treatment to verify RNA-dependent interactions

How does MTDH contribute to chemoresistance mechanisms?

MTDH contributes to chemoresistance through multiple mechanisms:

• RNA-binding activity: Functions as an RNA-binding protein that regulates expression of multiple mRNAs, such as PDCD10 and KDM6A

• DNA repair modulation: Blocks Rad51 nuclear accumulation, affecting homologous recombination repair processes

• Stress response regulation: Affects stress granule formation, providing survival advantage under therapeutic stress

• Cell cycle effects: MTDH depletion leads to G2/M arrest, suggesting its role in cell cycle progression

• Broad drug resistance: Confers resistance to both traditional chemotherapeutics and targeted agents such as BIBF1120 (a triple angiokinase inhibitor)

Experimental evidence shows MTDH knockdown significantly reduces colony formation after mitomycin C treatment and increases sensitivity to BIBF1120, demonstrating its broad role in therapeutic resistance .

What protein complexes involve MTDH and how can they be studied?

MTDH interacts with several key proteins forming functional complexes:

• MTDH-SND1 complex:

  • Critical for expansion and activity of tumor-initiating cells in breast cancer models

  • Essential for mammary tumor formation in MMTV-PyMT and MMTV-ErbB2 mouse models

• MTDH-ERG complex:

  • Identified in prostate cancer (VCaP cells)

  • Can be detected via co-immunoprecipitation with anti-MTDH and anti-SND1 antibodies

• MTDH-RNA-binding protein complexes:

  • Interactions with RPL4, NPM1, and components of the RNA-induced silencing complex

  • These interactions are nucleic acid-dependent

• MTDH-NF-κB regulatory complex:

  • MTDH interacts with RELA/p65

  • Can be studied using ChIP to verify NF-κB (RELA) interaction with the MTDH promoter region

For studying these complexes, co-immunoprecipitation followed by Western blotting or mass spectrometry is the method of choice .

What functional assays can evaluate the impact of MTDH modulation?

Several validated assays demonstrate MTDH's functional roles:

• Tumor sphere formation assay:

  • MTDH knockdown significantly reduces sphere-forming capability in PyMT and ErbB2 mouse mammary epithelial cells

  • Can be used to evaluate stem cell-like properties dependent on MTDH

• Colony formation assay:

  • MTDH depletion significantly decreases colony formation capacity, especially after treatment with DNA-damaging agents like mitomycin C

  • Protocol: Treat cells with mitomycin C for 24h, culture in normal medium for 2 weeks, stain with crystal violet and count colonies

• Cell viability assays:

  • WST-1 assay used to measure viability after treatment with BIBF1120 in MTDH-depleted versus control cells

  • Shows MTDH's role in therapeutic resistance

• In vivo tumor formation:

  • Injection of MTDH shRNA or control shRNA cells into athymic mice

  • MTDH knockdown significantly reduces tumor volume

  • Metastatic potential can be assessed by counting metastatic nodules

• Cell cycle analysis:

  • Click-iT EdU flow cytometry assay to analyze cell cycle distribution

  • MTDH depletion increases G2/M phase population, particularly under serum starvation

What are the critical factors affecting MTDH antibody specificity?

Several factors can impact MTDH antibody specificity and should be carefully considered:

• Antibody origin and characteristics:

  • Host species: Rabbit and mouse antibodies are most common

  • Clonality: Both monoclonal (e.g., clone 2F11C3) and polyclonal options are available

  • Epitope: Antibodies targeting different regions may yield different results

• Immunogen design:

  • Recombinant fragments vs. full-length protein

  • Example: Antibody 13860-1-AP uses AEG-1/MTDH fusion protein Ag4840 as immunogen

  • HPA015104 targets sequence: NSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPA

• Validation criteria:

  • Cross-reactivity: Some antibodies show cross-reactivity between species (human, mouse, rat)

  • Controls: Use MTDH knockdown cells as negative controls and known positive cell lines

• Post-translational modifications:

  • MTDH may undergo modifications affecting epitope recognition

  • Consider phospho-specific antibodies when studying signaling pathways

How should MTDH antibodies be stored and handled for optimal performance?

For optimal MTDH antibody performance:

• Storage conditions:

  • Most antibodies should be stored at -20°C for long-term stability

  • Avoid repeated freeze-thaw cycles by preparing working aliquots

• Buffer composition:

  • Many MTDH antibodies are supplied in PBS with 0.02% sodium azide and 50% glycerol at pH 7.3

  • This formulation enhances stability during storage

• Working dilution preparation:

  • Dilute in appropriate buffer immediately before use

  • For IHC applications, prepare fresh dilutions for each experiment

• Shelf life:

  • Most antibodies are stable for one year after shipment when stored properly

  • Always check for precipitation or contamination before use

What are common pitfalls when using MTDH antibodies in cancer tissue analysis?

Researchers should be aware of these common challenges:

• Heterogeneous expression:

  • MTDH expression varies across tumor types and even within the same tumor

  • Subgroup-specific expression patterns exist (e.g., elevated in MMSET translocation subgroup in multiple myeloma)

• Localization variability:

  • MTDH localizes to different cellular compartments (cytoplasm, nucleus, membrane)

  • Localization patterns may have prognostic significance (cytoplasmic predominance correlates with poor prognosis in prostate cancer)

• Technical challenges:

  • Antigen retrieval is critical: TE buffer pH 9.0 is recommended, with citrate buffer pH 6.0 as an alternative

  • Background staining: Optimize blocking conditions and antibody concentrations

  • Signal intensity: MTDH overexpression correlates with disease stage and may require adjusted exposure settings

• Interpretation complexity:

  • Multiple functions of MTDH require careful correlation with other markers

  • Consider dual staining with markers of relevant pathways (e.g., NF-κB components)

How can MTDH be targeted therapeutically in cancer?

Emerging research shows promising approaches to target MTDH:

• Antisense oligonucleotides (ASOs):

  • Locked nucleic acid-modified (LNA) MTDH ASOs effectively suppress MTDH expression both in vitro and in vivo

  • Treatment with MTDH ASOs significantly attenuated progression and metastasis of colorectal, lung, and breast cancers in mouse models

• Gene knockdown approaches:

  • shRNA targeting MTDH induces apoptosis and inhibits growth in multiple myeloma cells

  • MTDH-miRNA constructs have been developed to down-regulate proliferation, motility, and migration of breast carcinoma cells

• Combination approaches:

  • Bortezomib suppresses MTDH expression in multiple myeloma cell lines and primary samples

  • Mechanistic studies suggest MTDH may be activated by MMSET transcription in multiple myeloma

How does MTDH contribute to tumor-initiating cell functions?

MTDH plays critical roles in tumor-initiating cells:

• Mammary tumor models:

  • MTDH knockout significantly delays tumor onset in MMTV-PyMT and MMTV-ErbB2 mouse models

  • Total tumor burden reduced to 54% in heterozygous and 10% in homozygous knockout mice compared to wild-type

• Sphere formation capacity:

  • MTDH knockdown significantly reduces mammosphere formation

  • Restoring MTDH expression in knockout cells enhances sphere formation capability

• In vivo tumor initiation:

  • MTDH knockdown severely impairs tumor formation of PyMT primary mammary epithelial cells

  • MTDH restoration in knockout cells significantly enhances tumor formation

What is the relationship between MTDH and NF-κB signaling in cancer?

The MTDH-NF-κB axis represents an important mechanism in cancer progression:

• Bidirectional regulation:

  • MTDH activates NF-κB transcription through nuclear translocation of p65

  • NF-κB (RELA) potentially regulates MTDH expression through binding sites in the MTDH promoter

• Experimental approaches:

  • Chromatin immunoprecipitation (ChIP) can verify NF-κB (RELA) interaction with the MTDH promoter region

  • The Magna ChIP A-Chromatin Immunoprecipitation Kit has been validated for this purpose

  • Primary antibodies for detection include anti-MTDH (1:500, Millipore) and p-p65/p65 (1:1,000, Cell Signaling Technologies)

• Functional significance:

  • MTDH is essential for the tumorigenesis of hepatocellular carcinoma via NF-κB activation

  • This pathway represents a potential target for therapeutic intervention