MAK3 Antibody

What is the MAK3 Antibody and what is its target protein's function?

MAK3 Antibody is a rabbit polyclonal antibody specifically designed to detect MAK3 (also known as NAA30, N-alpha-acetyltransferase 30, or NatC catalytic subunit) in human samples. This antibody has been validated for Western Blot and Immunohistochemistry applications .

The target protein NAA30 functions as the catalytic subunit of the N-terminal acetyltransferase C (NatC) complex, which is responsible for N-terminal protein acetylation, a common post-translational modification. NAA30 has a molecular weight of approximately 39 kDa and plays an important role in cellular protein regulation .

The antibody is generated using synthetic peptides corresponding to the middle region of NAT12 (NP_001011713) with the peptide sequence: EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI . This region was specifically selected to maximize antibody specificity and minimize cross-reactivity with other proteins.

What applications has the MAK3 Antibody been validated for?

Based on the available research data, MAK3 Antibody has been validated for the following applications:

• Western Blot (recommended concentration: 1.0 μg/ml)

• Immunohistochemistry

When using this antibody for research purposes, it is critical to understand that validation for specific applications determines its reliability in experimental settings. The antibody has been used in at least two published studies, suggesting peer-reviewed validation of its performance .

What species reactivity has been confirmed for MAK3 Antibody?

MAK3 Antibody demonstrates reactivity with samples from multiple species:

Additionally, the antibody is expected to react with samples from pig, canine, equine, and rabbit sources . When conducting cross-species experiments, preliminary validation is recommended as reactivity can vary based on epitope conservation and experimental conditions.

How should MAK3 Antibody be stored and prepared for experiments?

Proper storage and preparation of MAK3 Antibody is essential for maintaining its performance over time:

Storage recommendations:

• Short-term storage: 4°C

• Long-term storage: -20°C (aliquoted to avoid repeated freeze-thaw cycles)

Preparation protocol:

• Centrifuge the vial of lyophilized antibody at 12,000 × g for 20 seconds

• Add 50 μL of distilled water

• Vortex thoroughly

• Centrifuge again to pellet the solution

• Final concentration will be 1 mg/mL in PBS buffer

It is crucial to avoid repeated freeze-thaw cycles, as these can significantly degrade antibody quality and reduce experimental reproducibility. Researchers should prepare small aliquots for regular use to preserve the stock solution.

What are the critical parameters for optimizing Western Blot protocols using MAK3 Antibody?

Optimizing Western Blot protocols with MAK3 Antibody requires attention to several critical parameters:

Sample preparation considerations:

• Use fresh samples when possible

• Include appropriate protease inhibitors during extraction

• Determine optimal protein loading (typically 10-30 μg of total protein)

• Ensure complete denaturation with appropriate SDS-PAGE conditions

Antibody incubation optimization:

• Starting concentration: 1.0 μg/ml as recommended

• Consider titrating the antibody (0.5-2.0 μg/ml) to determine optimal signal-to-noise ratio

• Incubation temperature: typically 4°C overnight or room temperature for 1-2 hours

• Blocking agents: test BSA vs. non-fat dry milk to determine which minimizes background

Detection system selection:

• Choose a detection system compatible with rabbit IgG primary antibodies

• Consider signal amplification methods for low-abundance targets

• Exposure time optimization: multiple exposures recommended to prevent signal saturation

It's important to note that antibody performance can vary between batches, so researchers should validate each new lot. This is particularly relevant for polyclonal antibodies like MAK3, where batch-to-batch variability may affect experimental outcomes .

How can researchers validate the specificity of MAK3 Antibody in their experimental system?

Thorough validation of MAK3 Antibody specificity is essential for reliable research outcomes. Researchers should implement multiple approaches:

Positive and negative controls:

• Positive controls: Samples with confirmed NAA30 expression (e.g., cell lines with known expression levels)

• Negative controls:

  • Primary antibody omission

  • Samples with NAA30 knockdown or knockout

  • Pre-absorption with immunizing peptide (EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI)

Molecular weight verification:

• Confirm observed band molecular weight matches expected 39 kDa

• Run molecular weight ladder alongside samples

• Investigate additional bands if present (potential isoforms or degradation products)

Orthogonal techniques:

• Compare results across different detection methods (e.g., Western blot vs. immunohistochemistry)

• Verify with recombinant expression systems

• Consider using alternative antibodies targeting different epitopes of NAA30

Proper validation is critical as antibody specificity directly impacts data interpretation. The scientific community increasingly emphasizes the importance of antibody validation in ensuring experimental reproducibility .

What methodological approaches can address cross-reactivity concerns with MAK3 Antibody?

Cross-reactivity can significantly impact experimental results. Researchers can implement several methodological approaches to address this concern:

Epitope analysis and prediction:

• Review the immunogen sequence (EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI) for homology with other proteins

• Use bioinformatic tools to predict potential cross-reactive proteins

• Consider performing BLAST analysis against proteome databases

Experimental verification:

• Immunoprecipitation followed by mass spectrometry to identify all proteins captured

• Competitive binding assays with purified proteins

• Side-by-side comparison with antibodies targeting different epitopes

Specificity enhancement strategies:

• Affinity purification against the immunizing peptide

• Pre-absorption with proteins showing potential cross-reactivity

• Optimization of washing conditions to reduce non-specific binding

How does the sequence homology of NAA30 across species impact experimental design with MAK3 Antibody?

The sequence homology of NAA30 across species has important implications for experimental design:

Homology analysis impact:

• Human and bovine samples: Expected 100% identity with immunogen sequence

• Mouse and rat samples: Expected 90% identity with immunogen sequence

• Other species (pig, canine, equine, rabbit): Reactivity predicted but requires validation

Experimental design considerations:

• For human studies: Direct application with high confidence

• For rodent studies: Validation necessary due to 10% sequence divergence

• For cross-species comparisons: Preliminary verification of equivalent epitope recognition

Validation approaches for cross-species experiments:

• Western blot comparison across species with equal protein loading

• Peptide competition assays with species-specific peptides

• Epitope mapping to identify regions of conservation and divergence

What are common Western Blot troubleshooting strategies when using MAK3 Antibody?

When encountering challenges with Western Blot experiments using MAK3 Antibody, consider these targeted troubleshooting strategies:

Weak or no signal issues:

• Increase antibody concentration (start with 1.0 μg/ml, then gradually increase if needed)

• Extend primary antibody incubation time (4°C overnight)

• Enhance protein loading (30-50 μg total protein)

• Verify sample integrity with housekeeping protein detection

• Use more sensitive detection systems (e.g., enhanced chemiluminescence)

High background issues:

• Optimize blocking conditions (test 5% BSA vs. 5% non-fat dry milk)

• Increase washing duration and frequency

• Decrease antibody concentration

• Filter antibody solution before use

• Use freshly prepared buffers

Multiple or unexpected bands:

• Optimize sample preparation (add phosphatase and protease inhibitors)

• Reduce protein loading to minimize non-specific binding

• Verify bands with positive and negative controls

• Consider pre-absorbing antibody with non-specific proteins

• Test different reducing conditions

When interpreting results, remember that polyclonal antibodies may recognize multiple epitopes on the target protein, potentially resulting in several bands representing different protein states or isoforms .

How should researchers approach conflicting results between MAK3 Antibody and other NAA30 detection methods?

Researchers frequently encounter discrepancies between different detection methods. A systematic approach to resolving conflicting results includes:

Methodological reconciliation strategy:

• Verify antibody specificity in both methods

• Compare sensitivities of different detection techniques

• Evaluate whether each method detects different protein states or modifications

• Consider differences in sample preparation between methods

• Assess technical limitations of each approach

Advanced verification approaches:

• Use genetic approaches (siRNA knockdown or CRISPR knockout) to verify specificity

• Implement orthogonal techniques (e.g., mass spectrometry)

• Test alternative antibodies targeting different epitopes

• Perform epitope mapping to understand detection discrepancies

• Compare results with transcriptional analysis (RT-PCR or RNA-seq)

Interpretation framework:

• Different antibodies may recognize different protein conformations or post-translational modifications

• Consider the biological context (cell type, treatment conditions)

• Evaluate subcellular localization differences that might affect detection

• Document all experimental variables to identify potential sources of variation

Scientific literature increasingly emphasizes the importance of using multiple detection methods to build confidence in research findings . Discrepancies should be viewed as opportunities to gain deeper insights into protein biology rather than simply experimental failures.

How can MAK3 Antibody be integrated into multiplex immunoassays for comprehensive protein interaction studies?

Multiplex immunoassays represent an advanced application for MAK3 Antibody, enabling researchers to study NAA30 in complex protein interaction networks:

Integration strategies:

• Antibody conjugation options:

  • Fluorescent labels (ensure spectral compatibility with other antibodies)

  • Biotin labeling for streptavidin-based detection systems

  • Bead-based assay integration

Multiplexing considerations:

• Validate antibody performance post-conjugation

• Perform single-antibody controls alongside multiplex experiments

• Test for cross-reactivity between multiplex components

• Optimize antibody concentrations individually before combining

Advanced applications:

• Co-immunoprecipitation to identify NAA30 binding partners

• Proximity ligation assays to visualize protein-protein interactions in situ

• ChIP-seq for identifying genomic binding sites (if applicable)

• Tissue microarray analysis for high-throughput screening

When designing multiplex experiments, researchers should consider the rabbit IgG isotype of MAK3 Antibody to ensure compatibility with other primary antibodies and detection systems. This approach allows researchers to study complex biological systems while maintaining experimental rigor.

What considerations are important when using MAK3 Antibody for quantitative protein expression analysis?

Quantitative protein expression analysis using MAK3 Antibody requires careful attention to several critical factors:

Sample preparation standardization:

• Consistent extraction methods across all experimental conditions

• Protein quantification with reliable methods (BCA or Bradford assays)

• Sample storage and handling protocols that preserve protein integrity

Quantification methodology options:

• Western blot densitometry:

  • Use appropriate reference proteins (GAPDH, β-actin)

  • Ensure detection is within linear range

  • Apply validated normalization methods

• ELISA development considerations:

  • Standard curve generation with recombinant protein

  • Spike-in recovery experiments to validate accuracy

  • Inter- and intra-assay variability assessment

Analytical considerations:

• Statistical approaches for comparing expression levels

• Technical replicates (minimum n=3) to assess reproducibility

• Biological replicates to account for natural variation

• Appropriate positive and negative controls

Researchers should be aware that the affinity-purified nature of this antibody makes it suitable for quantitative applications, but batch-to-batch variations may necessitate standardization between experiments for longitudinal studies.

How does the polyclonal nature of MAK3 Antibody impact its use in research compared to monoclonal alternatives?

The polyclonal nature of MAK3 Antibody has significant implications for research applications:

Comparative advantages of polyclonal MAK3 Antibody:

• Recognition of multiple epitopes increases detection sensitivity

• Greater robustness against minor conformational changes in target protein

• Potentially better performance in certain applications like immunohistochemistry

• Often works well across multiple species due to recognition of conserved epitopes

Limitations relative to monoclonal antibodies:

• Batch-to-batch variability requires consistent validation

• Potential for higher background due to diverse antibody population

• Less specificity for distinguishing closely related proteins

• May recognize post-translational modifications inconsistently

Application-specific considerations:

• Western blot: Polyclonal antibodies may detect multiple bands (isoforms, degradation products)

• Immunoprecipitation: Higher sensitivity but potentially lower specificity

• Flow cytometry: May require more stringent gating strategies

• Immunohistochemistry: Often provides stronger signal but requires careful validation

Recent research has demonstrated that the human immune system can generate up to one quintillion unique antibodies , highlighting the complexity and diversity of polyclonal responses. Understanding these dynamics helps researchers interpret results obtained with polyclonal antibodies like MAK3.

How might emerging AI technologies enhance MAK3 Antibody applications in research?

Artificial intelligence technologies are poised to transform antibody research, with several potential applications for MAK3 Antibody:

AI-enhanced antibody characterization:

• Epitope mapping through computational prediction algorithms

• Structure-function relationship modeling

• Cross-reactivity prediction across species and proteins

• Binding affinity estimation through machine learning approaches

Advanced experimental design:

• Optimization of experimental conditions through predictive modeling

• Automated image analysis for immunohistochemistry results

• Pattern recognition in complex datasets

• Predictive analytics for experimental outcomes

Future development potential:

• Design of improved versions with enhanced specificity

• Creation of synthetic antibodies based on binding characteristics

• Integration with large-scale antibody-antigen databases

• AI-driven epitope selection for next-generation antibodies

Recent developments at Vanderbilt University Medical Center demonstrate the potential of AI in antibody research, with their $30 million ARPA-H funded project aimed at using artificial intelligence technologies to generate antibody therapies against any antigen target of interest . This technology could potentially be applied to develop improved versions of antibodies like MAK3 with enhanced specificity and reduced batch-to-batch variability.

What role could MAK3 Antibody play in understanding protein acetylation mechanisms in disease contexts?

MAK3 Antibody targets NAA30, a key component of the N-terminal acetyltransferase C complex, positioning it as a valuable tool for investigating protein acetylation in disease:

Research applications in disease mechanisms:

• Profiling NAA30 expression across normal and pathological tissues

• Investigating role of N-terminal acetylation in protein stability and function

• Correlating NAA30 levels with disease progression or treatment response

• Studying NAA30 interactions with disease-relevant proteins

Methodological approaches:

• Tissue microarray analysis of patient samples

• Cell-based models of disease with NAA30 manipulation

• Animal models with altered NAA30 expression

• Correlation of acetylation patterns with clinical outcomes

Translational potential:

• Biomarker development for diseases with altered acetylation profiles

• Target validation for therapeutic development

• Patient stratification based on NAA30 expression patterns

• Companion diagnostics for treatments affecting protein acetylation

As our understanding of protein post-translational modifications in disease continues to evolve, antibodies like MAK3 that target key regulatory enzymes will be essential research tools. The continued refinement of antibody reporting and validation standards will further enhance the reliability of such research .

What quality control criteria should researchers apply when evaluating MAK3 Antibody performance?

Rigorous quality control is essential for ensuring reliable results with MAK3 Antibody:

Pre-experimental validation:

• Confirmation of reactivity with positive control samples

• Assessment of lot-to-lot consistency

• Verification of antibody concentration and activity

• Testing for contamination or degradation

Application-specific quality metrics:

• Western blot:

  • Signal-to-noise ratio

  • Band specificity at expected molecular weight (39 kDa)

  • Reproducibility across technical replicates

• Immunohistochemistry:

  • Staining pattern consistency

  • Background levels

  • Cellular localization specificity

  • Comparison with literature-reported patterns

Documentation requirements:

• Detailed recording of antibody source, catalog number (Bio-Techne NBP1-70631)

• Lot number and validation date

• Experimental conditions (concentration, incubation times)

• Complete protocol documentation for reproducibility

The scientific community increasingly emphasizes proper antibody reporting to enhance experimental reproducibility . Researchers should maintain detailed records of antibody performance across experiments to identify any variations that might affect results.

How should researchers account for batch-to-batch variability when using MAK3 Antibody in longitudinal studies?

Batch-to-batch variability represents a significant challenge for longitudinal studies using polyclonal antibodies like MAK3:

Proactive management strategies:

• Purchase sufficient quantities of a single lot for entire study when possible

• Perform side-by-side validation of new batches with original lot

• Maintain internal reference standards for normalization

• Document lot numbers used for each experiment

Comparative validation protocol:

• Run parallel Western blots with old and new antibody lots

• Compare staining patterns in immunohistochemistry

• Quantify signal intensity differences

• Assess background levels across batches

• Develop correction factors if necessary

Experimental design adaptations:

• Include consistent positive controls across all experiments

• Consider using pooled samples as internal standards

• Implement technical replicates to distinguish batch effects from biological variation

• Use statistical methods that account for batch effects in data analysis

Proper reporting of antibody information, including lot numbers and validation data, is essential for research reproducibility . When significant batch variations are observed, researchers should consider this limitation when interpreting results and explicitly acknowledge it in publications.

What are the optimal sample preparation methods for different applications of MAK3 Antibody?

Optimizing sample preparation is crucial for successful experiments with MAK3 Antibody across different applications:

Western Blot sample preparation:

• Lysis buffer composition: RIPA buffer with protease inhibitors

• Sample processing: Sonication or needle homogenization to ensure complete lysis

• Storage conditions: Aliquot and store at -80°C to avoid freeze-thaw cycles

• Protein quantification: BCA or Bradford assay for accurate loading

• Denaturation conditions: 95°C for 5 minutes in Laemmli buffer with β-mercaptoethanol

Immunohistochemistry sample preparation:

• Fixation method: 10% neutral buffered formalin (24-48 hours)

• Processing protocol: Standard paraffin embedding

• Section thickness: 4-5 μm sections

• Antigen retrieval: Heat-induced epitope retrieval (citrate buffer pH 6.0)

• Blocking conditions: 5% normal goat serum to reduce background

General considerations across applications:

• Include phosphatase inhibitors if phosphorylation status is relevant

• Minimize freeze-thaw cycles of samples

• Standardize preparation protocols across experimental groups

• Process all experimental conditions in parallel when possible

• Validate each preparation method with positive control samples

Careful documentation of sample preparation protocols is essential for experimental reproducibility, particularly when using antibodies like MAK3 where performance may vary with sample preparation conditions .

How should researchers integrate MAK3 Antibody data with other molecular techniques for comprehensive protein characterization?

Comprehensive protein characterization requires integration of antibody-based detection with complementary molecular techniques:

Multi-omics integration strategy:

• Correlate protein detection with transcriptomic data (RNA-seq, qPCR)

• Combine with mass spectrometry for post-translational modification analysis

• Integrate with functional assays to correlate expression with activity

• Complement with structural biology techniques for mechanistic insights

Integrated experimental design:

• Parallel sample processing for different analytical platforms

• Consistent experimental conditions across techniques

• Time-course analyses to capture dynamic processes

• Careful sample tracking to ensure proper data integration

Data integration approaches:

• Correlation analysis between protein levels and mRNA expression

• Pathway analysis incorporating multiple data types

• Network modeling to identify functional relationships

• Machine learning approaches for pattern recognition across datasets

This integrated approach aligns with the evolving understanding of antibody repertoires, where researchers have discovered that the human body can generate up to one quintillion unique antibodies , highlighting the complexity of protein-antibody interactions and the need for multiple analytical approaches.

What are the essential reporting elements when publishing research using MAK3 Antibody?

Proper reporting of antibody information is crucial for research reproducibility. When publishing research using MAK3 Antibody, include:

Critical antibody information:

• Complete product identification: MAK3 Antibody, Novus Biologicals, Catalog #NBP1-70631, RRID (if available)

• Antibody characteristics: Rabbit polyclonal, unconjugated

• Target information: NAA30, 39 kDa molecular weight

• Immunogen details: Synthetic peptide EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI

• Lot number and manufacturing date

Experimental methodology details:

• Specific application used (Western blot, immunohistochemistry)

• Working concentration employed (e.g., 1.0 μg/ml for Western blot)

• Complete protocols including blocking, incubation, and washing conditions

• Detection systems and imaging parameters

• Positive and negative controls utilized

Validation information:

• Specificity validation approach

• Quantification methods if applicable

• Replication strategy (technical and biological)

• Limitations observed during experiments

The importance of proper antibody reporting has been increasingly emphasized in scientific literature to address reproducibility challenges . Journal editors and reviewers now frequently require detailed antibody information as part of manuscript submission requirements.

How can researchers enhance reproducibility when publishing experiments using MAK3 Antibody?

Enhancing research reproducibility requires attention to several key factors:

Experimental design considerations:

• Implement rigorous controls (positive, negative, isotype)

• Include adequate biological and technical replicates

• Blind analysis where appropriate

• Pre-register experimental protocols when possible

• Use statistical power calculations to determine sample sizes

Detailed methodology documentation:

• Provide step-by-step protocols with sufficient detail for replication

• Include buffer compositions and preparation methods

• Document antibody validation procedure

• Report batch/lot information

• Share raw data and analysis scripts when possible

Transparency in limitations:

• Acknowledge technical challenges encountered

• Discuss potential alternative interpretations

• Note experimental conditions where antibody performance varied

• Address discrepancies with previous literature

• Indicate batch-to-batch variability if observed

The scientific community's understanding of antibody specificity has evolved significantly, with research showing that people share an average of only 0.95% antibody clonotypes, highlighting the complexity of antibody-antigen interactions and the importance of robust validation .