NABP2 Antibody

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Structure

NABP2 is a protein that belongs to the SSB (single-stranded DNA-binding) protein family and is also known by several synonyms including hSSB1, MGC2731, OBFC2B, SOSS-B1, and SSB1 . The NABP2 gene is located on Chromosome 12 in humans and encodes a protein that functions as a component of the SOSS (Sensor Of Single-Stranded DNA) complex . This protein acts as a sensor of single-stranded DNA with particular affinity for polypyrimidines, making it crucial for genomic stability maintenance .

Biological Function

NABP2 serves as a critical component in cellular DNA damage response mechanisms. As described in research findings, NABP2 functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint activation . The SOSS complex, which contains NABP2, associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response, including cell-cycle checkpoint activation, recombinational repair, and maintenance of genomic stability . NABP2 is specifically required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways, highlighting its central role in preserving genomic integrity .

Antibody Production and Purification

Most commercially available NABP2 antibodies are produced in rabbits using specific peptide sequences as immunogens. The production processes typically involve rigorous purification steps to ensure specificity and reduce background signals. For instance, ProSci's 55-934 antibody undergoes purification through a protein A column, followed by peptide affinity purification . This ensures high specificity for the target protein while minimizing cross-reactivity with other cellular components.

The immunogens used for antibody production vary between manufacturers. Sigma-Aldrich's HPA057213 antibody, for example, is raised against a synthetic peptide with the sequence "FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS" . Similarly, Abcam's ab85752 is generated using a synthetic peptide within Human NABP2 amino acid range 150 to C-terminus . ProSci's antibody targets the amino acid range 183-211 of the NABP2 protein . These different epitope targets may result in varying specificity and application performance between antibodies.

Applications and Validation

NABP2 antibodies serve various experimental purposes, with validation data supporting their use across multiple techniques.

Table 2: Common Applications for NABP2 Antibodies and Working Conditions

ApplicationDescriptionTypical Working Conditions
Western Blot (WB)Detection of NABP2 in protein lysates0.4 μg/mL (Abcam ab85752)
Immunohistochemistry (IHC)Visualization in tissue sections1/1000 dilution (1 μg/ml) (Abcam ab85752)
Immunoprecipitation (IP)Isolation of NABP2 complexes3 μg/mg lysate (Abcam ab85752)
Immunofluorescence (IF)Cellular localization studies0.25-2 μg/mL (Sigma-Aldrich HPA057213)
ELISA (EL)Quantitative protein detectionVariable by manufacturer

Validation examples include Western blot analysis with Abcam's ab85752 showing bands at approximately 33 kDa and 38 kDa, which differ from the predicted size of 23 kDa, possibly indicating post-translational modifications . The same antibody has been validated for immunohistochemistry on human colon carcinoma and mouse squamous cell carcinoma tissues, demonstrating specific cellular staining patterns .

DNA Damage Response Studies

NABP2 antibodies have proven instrumental in elucidating the role of NABP2 in DNA damage response pathways. These antibodies allow researchers to track NABP2 protein levels, subcellular localization, and interactions with other DNA repair proteins under various experimental conditions. For instance, NABP2's association with the SOSS complex and its role in promoting DNA repair and G2/M checkpoint activation have been established in part through antibody-based detection methods .

Cancer Research

Research utilizing NABP2 antibodies has revealed significant implications for cancer biology, particularly in hepatocellular carcinoma (HCC). A comprehensive study described in the search results employed various antibody-based techniques to demonstrate that NABP2 is substantially overexpressed in HCC tissues compared to normal liver tissues . Importantly, this overexpression correlates with several clinicopathological features and patient outcomes.

Table 3: Correlation of NABP2 Expression with Clinical Parameters in HCC

These findings were validated through immunohistochemistry and Western blotting analyses, confirming elevated NABP2 protein expression in HCC samples . The research demonstrates the value of NABP2 antibodies in translational cancer research and suggests NABP2 detection could have prognostic value.

Immune Microenvironment Analysis

A particularly interesting application of NABP2 antibodies involves studying the relationship between NABP2 expression and the tumor immune microenvironment. Research has shown that NABP2 expression levels correlate with immune cell infiltration patterns in HCC . Specifically, high NABP2 expression correlates with:

  • Decreased infiltration of cytotoxic cells, CD8+ T cells, and dendritic cells (negative correlation)

  • Increased presence of Th2 cells and NK CD56bright cells (positive correlation)

  • Significant positive correlation with cancer-associated fibroblasts (CAFs) and myeloid-derived suppressor cells (MDSCs)

These findings suggest that NABP2 may influence the tumor immune microenvironment, potentially creating immunosuppressive conditions that favor cancer progression. Such insights would not be possible without the availability of specific NABP2 antibodies for detection and quantification studies.

Functional Validation through Knockdown Studies

Research utilizing NABP2 antibodies in conjunction with RNA interference techniques has provided functional validation of NABP2's role in cancer progression. In HCC cell lines, siRNA-mediated knockdown of NABP2 resulted in:

  • Reduced cell proliferation as assessed by EdU assay

  • Diminished migration ability demonstrated through wound healing assays and Transwell experiments

  • These effects were verified using Western blot with NABP2 antibodies to confirm successful protein depletion

These experiments not only validate the specificity of NABP2 antibodies but also establish NABP2 as a promoter of malignant phenotypes in HCC cells, suggesting its potential as a therapeutic target.

NABP2 as a Prognostic Biomarker

The research findings utilizing NABP2 antibodies strongly support the potential of NABP2 as a prognostic biomarker in multiple cancers. Cox regression analysis demonstrated that NABP2 has significant prognostic value in several cancer types beyond HCC, including adrenocortical carcinoma (ACC), bladder urothelial carcinoma (BLCA), cervical squamous cell carcinoma (CESC), head and neck squamous cell carcinoma (HNSC), kidney renal papillary cell carcinoma (KIRP), and uveal melanoma (UVM) .

In HCC specifically, ROC curve analysis confirmed significant diagnostic value for NABP2, and survival analyses across various clinical subgroups consistently showed that high NABP2 expression was associated with poorer outcomes . These findings suggest that antibody-based detection of NABP2 could potentially be developed into a clinical test for cancer prognosis.

Relationship with Immune Checkpoints

NABP2 antibody-based research has uncovered important correlations between NABP2 expression and immune checkpoint molecules in HCC. High NABP2 expression positively correlates with multiple immune checkpoints, including PDCD1 (PD-1), CD274 (PD-L1), CD276, CTLA4, LGALS9, TNFRSF18, TNFRSF4, and TNFRSF14 . Analysis of an additional dataset (GSE36376) confirmed these findings, showing particularly strong associations with TNFRSF25, ADORA2A, LGALS9, TNFSF4, TNFRSF9, LAIR1, and PDCD1 .

This correlation suggests that high NABP2 expression might affect the efficacy of immune checkpoint therapy in HCC patients, potentially contributing to treatment resistance mechanisms. Such insights highlight the value of NABP2 antibodies in discovering novel biomarkers that could predict immunotherapy response.

Chemotherapy Sensitivity Prediction

Research employing the R package pRRophetic has revealed relationships between NABP2 expression and sensitivity to anticancer drugs. Tumors with high NABP2 expression may show increased sensitivity to several anticancer agents, including tipifarnib, 5-fluorouracil, dasatinib, gemcitabine, and imatinib . This suggests that NABP2 expression levels, detectable through antibody-based methods, could potentially guide chemotherapy selection in cancer patients.

Development of Enhanced NABP2 Antibodies

Future research could focus on developing improved NABP2 antibodies with higher specificity, sensitivity, and versatility. Possibilities include:

  • Generation of monoclonal antibodies targeting specific post-translational modifications of NABP2

  • Development of antibody fragments with enhanced tissue penetration for in vivo imaging

  • Creation of antibody-drug conjugates targeting NABP2-overexpressing cancer cells

  • Engineering of conformation-specific antibodies that recognize NABP2 in its active or inactive forms

These advancements could expand the utility of NABP2 antibodies in both research and clinical settings.

Limitations of Current NABP2 Antibody Research

Despite the promising findings, several limitations exist in the current state of NABP2 antibody research:

  • The data utilized comes from various samples and laboratories, potentially introducing systematic bias

  • Bioinformatics analysis does not fully substitute for extensive experimental validation

  • The exact mechanisms by which NABP2 affects immune cell infiltration remain unclear and require further investigation

  • The observed bands in Western blot analyses (33 kDa and 38 kDa) differ from the predicted molecular weight of NABP2 (23 kDa), suggesting post-translational modifications that may not be uniformly detected by all antibodies

Translational Potential

NABP2 antibodies hold significant translational potential in cancer diagnostics and therapeutics:

  • Development of immunohistochemistry-based prognostic tests for cancer patients

  • Use of NABP2 status to stratify patients for specific treatment approaches

  • Monitoring NABP2 levels during treatment to assess response and resistance

  • Potential development of therapeutic antibodies targeting NABP2 in cancer cells

Product Specs

Buffer
PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid freeze / thaw cycles.
Lead Time
Typically, we can ship the products within 1-3 business days after receiving your orders. Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Synonyms
NABP2 antibody; OBFC2B antibody; SSB1 antibody; LP3587 antibody; SOSS complex subunit B1 antibody; Nucleic acid-binding protein 2 antibody; Oligonucleotide/oligosaccharide-binding fold-containing protein 2B antibody; Sensor of single-strand DNA complex subunit B1 antibody; Sensor of ssDNA subunit B1 antibody; SOSS-B1 antibody; Single-stranded DNA-binding protein 1 antibody; hSSB1 antibody
Target Names
NABP2
Uniprot No.

Target Background

Function
NABP2 antibody is a component of the SOSS complex, a multiprotein complex that operates downstream of the MRN complex. This complex plays a crucial role in promoting DNA repair and the G2/M checkpoint. Within the SOSS complex, NABP2 acts as a sensor of single-stranded DNA, specifically binding to polypyrimidines. The SOSS complex associates with DNA lesions and influences various aspects of the cellular DNA damage response, including cell-cycle checkpoint activation, recombinational repair, and the maintenance of genomic stability. NABP2 is essential for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.
Gene References Into Functions
  1. Research findings demonstrate a novel regulatory mechanism for NABP2 in the repair of damaged DNA. PMID: 27273218
  2. Our data highlights that BLM helicase and NABP2 function within a dynamic complex in cells, and this complex is likely crucial for BLM protein stability and function. PMID: 28506294
  3. This study reports the detailed molecular mechanism in solution of ssDNA binding by NABP2, a key player in maintaining genomic stability. PMID: 27387285
  4. In the absence of NABP2, human 8-oxoguanine glycosylase 1 does not localize to chromatin, leading to an accumulation of 8-oxoguanine in the genome. PMID: 26261212
  5. The findings demonstrate the importance of NABP2 in maintaining and repairing DNA replication forks and for overall genomic stability. PMID: 24753408
  6. Identification of EEf1E1 and OBFC2B as novel BRCA1-partner genes in the DNA double-strand break repair pathway. PMID: 24104880
  7. SOSS complexes, containing NABP2, do not colocalize with Replication Protein A (RPA) at replication sites in human cells, yet they have a significant impact on double-strand break resection and homologous recombination. PMID: 23178594
  8. Cells deficient in NABP2 exhibit increased radiosensitivity, defective checkpoint activation, and enhanced genomic instability coupled with a diminished capacity for DNA repair. PMID: 18449195
  9. INTS3 regulates the NABP2-mediated DNA damage response. PMID: 19786574
Database Links

HGNC: 28412

OMIM: 612104

KEGG: hsa:79035

STRING: 9606.ENSP00000267023

UniGene: Hs.240170

Protein Families
SOSS-B family, SOSS-B1 subfamily
Subcellular Location
Nucleus. Note=Localizes to nuclear foci following DNA damage. Foci formation is not cell-cycle dependent. Partial colocalization with RAD51 after ionizing radiation treatment.

Q&A

What is NABP2 and why is it significant in cancer research?

NABP2 (nucleic acid binding protein 2) is a member of the SSB (single-stranded DNA-binding) protein family that plays a crucial role in DNA damage repair mechanisms . Recent research has identified NABP2 as significantly overexpressed in hepatocellular carcinoma (HCC) samples compared to normal tissue, with this overexpression correlated with poor survival outcomes, advanced clinical staging, and higher tumor grades . The protein's involvement in critical cellular pathways including cell cycle regulation, DNA replication, G2M checkpoint control, E2F targets, apoptosis, and P53 signaling makes it particularly relevant for cancer research . When designing experiments to investigate NABP2, researchers should consider its dual role in both normal DNA repair processes and potential oncogenic functions in certain contexts.

What are the optimal conditions for using NABP2 antibodies in immunohistochemistry?

For optimal immunohistochemical detection of NABP2 in formalin-fixed, paraffin-embedded tissue sections, researchers should follow a protocol that includes appropriate antigen retrieval methods, typically using citrate buffer (pH 6.0) with heat-induced epitope retrieval. The search results indicate successful NABP2 detection in HCC tissue samples through immunohistochemistry . Antibody dilutions typically range from 1:100 to 1:500, but optimization is necessary for each specific antibody and tissue type. Incubation should be performed at 4°C overnight or at room temperature for 1-2 hours, followed by appropriate secondary antibody application. Validation through positive and negative controls is essential, with normal liver tissue serving as a crucial comparative control when examining HCC samples. Western blotting was also used in the referenced research to validate NABP2 expression findings, suggesting a multi-method approach for comprehensive protein detection .

How should researchers interpret NABP2 expression patterns in different cellular compartments?

NABP2 is predominantly a nuclear protein given its role in DNA damage repair, but researchers should carefully assess both nuclear and possible cytoplasmic expression patterns. When interpreting immunohistochemical staining of NABP2, researchers should quantify both the intensity and percentage of positive cells. The referenced study employed both immunohistochemistry and Western blotting to validate NABP2 expression in HCC . For accurate interpretation, researchers should establish a scoring system based on staining intensity (0=negative, 1=weak, 2=moderate, 3=strong) and percentage of positive cells, with a combined score calculated for statistical analysis. Differences in subcellular localization may indicate altered protein function and should be analyzed in relation to clinical parameters. The referenced research demonstrated that increased NABP2 expression correlated with tumor progression metrics, including T stage, pathologic stage, histological grade, and vascular invasion (p<0.001, p<0.001, p<0.001, and p=0.002, respectively) .

What controls should be included when conducting NABP2 knockdown experiments?

When designing NABP2 knockdown experiments, researchers should implement multiple controls to ensure valid and interpretable results. The search results describe successful NABP2 knockdown using siRNA to validate its role in hepatocellular carcinoma . Essential controls include:

  • Non-targeting siRNA control: To account for non-specific effects of the transfection process

  • Multiple siRNA sequences targeting different regions of NABP2: To confirm specificity and rule out off-target effects

  • Rescue experiments: Re-expressing siRNA-resistant NABP2 to confirm phenotype reversibility

  • Quantitative validation: Western blotting and qRT-PCR to confirm knockdown efficiency (typically aiming for >70% reduction)

  • Time-course analysis: Evaluating knockdown stability over the experimental period

The referenced study validated the effects of NABP2 knockdown on proliferation through EdU assays and on migration through wound-healing and transwell experiments, demonstrating that NABP2 enhances both proliferation and migration capabilities of liver cancer cells . These functional assays are essential for establishing the biological significance of NABP2 in cancer progression.

How can researchers effectively analyze the correlation between NABP2 expression and immune cell infiltration?

To analyze correlations between NABP2 expression and immune cell infiltration in tumor samples, researchers should employ multiple computational and experimental approaches. The referenced study calculated Spearman correlations between NABP2 expression and infiltration levels of major immune cell types in HCC . Researchers should:

  • Utilize computational methods such as ssGSEA (single-sample Gene Set Enrichment Analysis) to estimate immune cell infiltration levels from transcriptomic data

  • Apply multiple algorithms (e.g., TIMER2.0, CIBERSORT) to corroborate findings across different computational approaches

  • Stratify samples into high and low NABP2 expression groups for comparative analysis

  • Validate computational findings using multiplex immunofluorescence or flow cytometry on tissue samples

  • Analyze specific immune cell subsets with known tumor-promoting or tumor-suppressing functions

The referenced research revealed that NABP2 expression negatively correlated with infiltration of cytotoxic cells, CD8+ T cells, and dendritic cells, while positively correlating with Th2 cells, NK CD56bright cells, cancer-associated fibroblasts (CAFs), and myeloid-derived suppressor cells (MDSCs) . This immunoregulatory profile suggests that NABP2 may contribute to an immunosuppressive tumor microenvironment, which has significant implications for immunotherapy approaches.

What methodological approaches can best elucidate the prognostic value of NABP2 in cancer?

To rigorously establish the prognostic value of NABP2 in cancer, researchers should implement a multi-faceted methodological approach:

  • Multi-cohort analysis: Analyze NABP2 expression across diverse patient cohorts (e.g., TCGA, GEO datasets) to confirm consistent prognostic patterns

  • Survival analysis: Employ Kaplan-Meier curves with log-rank tests to compare survival outcomes between high and low NABP2 expression groups

  • Multivariate Cox regression: Adjust for established prognostic factors to determine independent prognostic value

  • Stratified analysis: Examine prognostic significance across different clinical subgroups

  • Integrated biomarker panels: Evaluate NABP2 in combination with other biomarkers for improved prognostic accuracy

The referenced study demonstrated that NABP2 overexpression in HCC correlated with poor survival outcomes and advanced clinical features, including tumor stage, grade, and vascular invasion . The study employed univariate logistic regression analysis, which showed significant odds ratios for multiple clinical parameters: T stage [OR=2.205 (1.449–3.377), p<0.001], pathologic stage [OR=2.196 (1.432–3.389), p<0.001], histological grade [OR=1.998 (1.109–3.702), p=0.024], and vascular invasion [OR=2.083 (1.305–3.354), p=0.002] .

How should researchers investigate the relationship between NABP2 and immune checkpoint expression in tumor samples?

Investigation of NABP2's relationship with immune checkpoint molecules requires a systematic approach combining transcriptomic analysis with functional validation. The referenced study revealed significant correlations between NABP2 expression and several immune checkpoint molecules in HCC . Researchers should:

  • Analyze co-expression patterns between NABP2 and established checkpoint molecules (e.g., PDCD1, CD274, CTLA4) using RNA-seq or microarray data

  • Validate protein-level correlations through multiplex immunohistochemistry or western blotting

  • Implement in vitro co-culture systems with immune cells to assess functional interactions

  • Evaluate the impact of NABP2 knockdown/overexpression on checkpoint molecule expression

  • Assess potential synergistic effects of targeting both NABP2 and immune checkpoints in preclinical models

The referenced research demonstrated significant correlations between NABP2 expression and several immune checkpoint molecules, including PDCD1, CD274 (PD-L1), CD276, CTLA4, LGALS9, TNFRSF18, TNFRSF4, and TNFRSF14 . This suggests that NABP2 may influence the efficacy of immune checkpoint inhibitor therapies in HCC, representing an important area for translational research.

What strategies can researchers employ to understand the molecular mechanisms connecting NABP2 to cancer progression?

To elucidate the molecular mechanisms through which NABP2 contributes to cancer progression, researchers should implement a comprehensive experimental strategy:

  • Pathway analysis: Conduct functional enrichment analysis to identify key pathways associated with NABP2 expression

  • Protein-protein interaction studies: Employ co-immunoprecipitation and mass spectrometry to identify NABP2 binding partners

  • ChIP-seq analysis: Determine genomic binding sites and potential transcriptional targets of NABP2

  • CRISPR/Cas9 gene editing: Generate knockout models to assess the consequences of complete NABP2 loss

  • Signaling pathway inhibitors: Use targeted inhibitors to identify the dependency of NABP2 function on specific signaling pathways

Functional enrichment analysis in the referenced study indicated NABP2's potential involvement in cell cycle regulation, DNA replication, G2M checkpoint control, E2F targets, apoptosis, P53 signaling, and TGFA signaling via NF-κB . In vitro experiments confirmed NABP2's promotion of proliferation and migration in hepatocellular carcinoma cells, validating its functional significance in cancer progression .

How can researchers effectively study the differential role of NABP2 across diverse cancer types and subtypes?

To investigate NABP2's potentially diverse roles across different cancer types and subtypes, researchers should employ a comparative oncology approach:

  • Pan-cancer analysis: Analyze NABP2 expression patterns across multiple cancer types using large-scale databases (TCGA, ICGC)

  • Cancer subtype stratification: Examine NABP2 expression and function across molecular subtypes within each cancer type

  • Comparative functional studies: Assess the effects of NABP2 manipulation in cell lines representing different cancer types/subtypes

  • Context-dependent interactome analysis: Identify tissue-specific or subtype-specific protein interaction networks

  • Cross-species oncology: Evaluate NABP2's role in animal models of different cancer types

The referenced research primarily focused on hepatocellular carcinoma, where NABP2 was found to be overexpressed and correlated with poor prognosis . Researchers investigating other cancer types should employ similar methodologies while acknowledging potential context-dependent functions. This may include analysis of clinical correlations, functional assays specific to each cancer type, and evaluation of tumor microenvironment interactions.

What is the relationship between NABP2 expression and clinical parameters in hepatocellular carcinoma?

The relationship between NABP2 expression and clinical parameters in HCC has been extensively analyzed, revealing significant associations with disease progression markers. Based on the TCGA-LIHC cohort analysis presented in the search results, NABP2 expression increases significantly with:

  • Advanced T stage (p<0.001)

  • Advanced pathologic stage (p<0.001)

  • Higher histological tumor grade (p<0.001)

  • Presence of vascular invasion (p=0.003)

  • Elevated AFP levels (>400 ng/mL) (p=0.036)

These relationships are quantified in the following table from the referenced study:

CharacteristicsOdds Ratio (OR)P value
T stage (T2&T3 vs T1)2.205 (1.449–3.377)<0.001***
Pathologic stage (Stage II & Stage III vs Stage I)2.196 (1.432–3.389)<0.001***
Histologic grade (G2&G3 vs G1)1.998 (1.109–3.702)0.024*
Vascular invasion (Yes vs No)2.083 (1.305–3.354)0.002**

Notably, NABP2 expression did not significantly differ based on patient age, gender, N stage, or M stage . These findings suggest that NABP2 expression is most strongly associated with features of local tumor progression rather than distant metastasis, though the search results also indicated higher NABP2 expression in patients with metastasis compared to those without .

How can NABP2 antibodies be utilized in monitoring treatment response in cancer patients?

NABP2 antibodies can serve as valuable tools for monitoring treatment response in cancer patients through several methodological approaches:

  • Serial tissue biopsies: Analyze NABP2 expression changes before and after treatment

  • Liquid biopsy applications: Develop assays to detect NABP2 in circulating tumor cells or extracellular vesicles

  • Immunotherapy response prediction: Correlate baseline NABP2 expression with immunotherapy outcomes

  • Treatment resistance monitoring: Track NABP2 expression changes in developing resistance

  • Combination with other biomarkers: Integrate NABP2 status with established response biomarkers

The referenced research indicated that chemotherapy sensitivity might be predicted based on NABP2 expression levels, with several anticancer drugs showing potentially greater efficacy in tumors with high NABP2 expression, including tipifarnib, 5-fluorouracil, dasatinib, gemcitabine, and imatinib . Additionally, the correlation between NABP2 and immune checkpoint molecules suggests potential utility in monitoring immunotherapy response, though this requires prospective validation in clinical trials.

What methodological considerations should be addressed when developing NABP2 as a prognostic biomarker for clinical use?

Developing NABP2 as a clinically applicable prognostic biomarker requires addressing several methodological considerations:

  • Analytical validation: Establish standardized, reproducible protocols for NABP2 detection with defined performance characteristics

  • Clinical validation: Confirm prognostic value in prospective, multicenter studies with diverse patient populations

  • Cutoff optimization: Determine optimal expression thresholds for prognostic stratification

  • Integration into existing models: Assess added value when combined with established prognostic factors

  • Practical implementation: Develop clinically practical assays suitable for routine diagnostic laboratories

How can researchers address antibody specificity concerns when studying NABP2?

Addressing antibody specificity concerns is crucial for generating reliable NABP2 research data. Researchers should implement the following methodological approaches:

  • Multiple antibody validation: Use at least two antibodies targeting different epitopes of NABP2

  • Knockout/knockdown controls: Include NABP2 knockout or knockdown samples as negative controls

  • Preabsorption tests: Demonstrate signal elimination after antibody preincubation with purified NABP2 protein

  • Cross-reactivity assessment: Test antibody against closely related family members (other SSB proteins)

  • Multiple detection methods: Confirm findings using orthogonal techniques (western blot, immunofluorescence, ELISA)

The referenced research employed both immunohistochemistry and western blotting to validate NABP2 expression in HCC samples . Additionally, the functional validation through siRNA knockdown experiments provides further confidence in antibody specificity, as the phenotypic effects observed after NABP2 depletion confirm the biological relevance of the detected protein .

What are the key considerations for resolving contradictory data about NABP2 function across different experimental systems?

When facing contradictory data about NABP2 function across different experimental systems, researchers should implement a systematic approach to reconciliation:

  • Context evaluation: Assess differences in cellular context (cancer type, cell line, differentiation state)

  • Methodology comparison: Evaluate differences in experimental approaches, antibodies, or detection methods

  • Dose-dependent effects: Investigate whether NABP2 exhibits dose-dependent functions with different thresholds

  • Isoform analysis: Determine whether different NABP2 isoforms are being studied across experiments

  • Interaction partners: Identify context-specific protein interactors that may modify NABP2 function

While the referenced study focused primarily on hepatocellular carcinoma , researchers working across different experimental systems should carefully document all methodological details, including cell types, culture conditions, and specific reagents used. This facilitates more accurate cross-study comparisons and helps resolve apparent contradictions through identification of context-dependent variables.

How can researchers optimize NABP2 detection in challenging tissue samples?

Detection of NABP2 in challenging tissue samples requires optimization strategies to overcome technical limitations:

  • Antigen retrieval optimization: Test multiple retrieval methods (heat-induced vs. enzymatic, different pH buffers)

  • Signal amplification: Implement tyramide signal amplification or other amplification methods for low-abundance detection

  • Multiplex approaches: Combine NABP2 detection with cell-type markers for contextual analysis

  • Alternative fixation: Consider using alternative fixatives to formalin when preparing prospective samples

  • Microdissection: Use laser capture microdissection to isolate specific regions of interest

For archived or challenging samples, researchers should implement rigorous quality control steps, including assessment of RNA/protein integrity, testing of housekeeping gene/protein detection, and inclusion of appropriate technical controls. The referenced study successfully detected NABP2 in HCC tissue samples through both immunohistochemistry and western blotting , suggesting these methods can be effectively optimized for reliable detection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.