NBEAL1 Antibody

What is NBEAL1 and what cellular functions does it perform?

NBEAL1 is a poorly characterized BEACH (Beige and Chediak-Higashi) domain protein that belongs to a family of nine human proteins. It functions primarily as a Golgi-associated protein required for regulation of cholesterol metabolism . Research has identified NBEAL1 as a modulator of SREBP2 activity and processing, affecting low-density lipoprotein (LDL) uptake and receptor expression through interactions with SCAP and PAQR3 . Notably, NBEAL1 exhibits highest expression in arterial tissues according to GTEx Portal database analysis, with the longest isoform (ENST00000449802) showing predominant expression across all tissues including arteries .

What is the molecular structure of NBEAL1 protein?

NBEAL1 shares the modular structure characteristic of BEACH proteins, featuring a C-terminal pleckstrin homology (PH) domain, BEACH domain, and WD40 repeat domain assembly. Additionally, NBEAL1 contains a distinctive Concanavalin A (ConA)-like lectin domain . Multiple isoforms of NBEAL1 have been identified through cloning and sequencing, particularly from U2OS cell cDNA. For instance, one identified isoform matched NM_001114132.1 (9058 base pairs) but lacked base pairs 639-848 corresponding to exon 5-6 (amino acids 10-172), while still preserving the predicted modular structure . The functional significance of these different isoforms remains to be fully elucidated.

How are NBEAL1 genetic variants associated with disease?

Genetic variants in NBEAL1 have been associated with decreased expression of NBEAL1 in arteries and increased risk of coronary artery disease (CAD) in humans . Specifically, the variant rs115654617 strongly associates with decreased expression of NBEAL1 in arteries, adipose tissue, nerve, lung, and skin . This genetic association suggests that low expression of NBEAL1 may contribute to CAD risk through mechanisms involving downregulation of LDLR levels and subsequent dysregulation of cholesterol homeostasis .

What types of NBEAL1 antibodies are currently available for research?

Several commercial NBEAL1 antibodies are available for research applications. These include rabbit polyclonal antibodies such as those offered by Novus Biologicals (NBP2-33553) and Sigma-Aldrich (HPA049447) . These antibodies are typically developed against recombinant protein fragments of NBEAL1. For example, the Novus antibody was developed against a recombinant protein corresponding to amino acids: QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE , while the Sigma antibody targets the sequence: TIPNLAISWEGHIVVYSSTEEKTTLKDKNALHLFSINGKYLGSQILKEQVSDICIIGEHIVTGSIQGFLSIRDLHSLNLSINPLAMRLPIHCVCVTKEYS .

What validation methods should be employed when selecting NBEAL1 antibodies?

When selecting NBEAL1 antibodies, researchers should confirm validation across multiple techniques relevant to their planned applications. High-quality antibodies should be validated through:

• Specificity testing against arrays containing target protein plus non-specific proteins

• Western blot analysis showing bands of expected molecular weight

• Immunohistochemistry in tissues known to express NBEAL1 (particularly arterial tissues)

• Positive and negative control tissues/cell lines

The lack of commercial antibodies noted in some research highlights the importance of thorough validation . When evaluating validation data, researchers should examine specificity, sensitivity, and reproducibility across different experimental conditions.

What are the optimized storage conditions for NBEAL1 antibodies?

NBEAL1 antibodies typically require storage at 4°C for short-term use. For long-term storage, aliquoting and maintaining at -20°C is recommended to avoid freeze-thaw cycles that can degrade antibody quality . Most commercial NBEAL1 antibodies are supplied in buffered aqueous glycerol solutions (typically PBS at pH 7.2 with 40% glycerol and 0.02% sodium azide) . This formulation helps maintain antibody stability during storage.

What are the optimal protocols for NBEAL1 antibody application in immunohistochemistry?

For immunohistochemistry (IHC) applications with NBEAL1 antibodies, the following methodological considerations are important:

Antigen Retrieval: Heat-induced epitope retrieval is generally recommended, though specific buffer conditions may vary depending on the tissue type and fixation method.

Detection Systems: For polyclonal NBEAL1 antibodies, polymer-based detection systems often provide optimal signal-to-noise ratio.

Controls: Given NBEAL1's differential expression across tissues, arterial tissue should be considered as a positive control, as NBEAL1 shows highest expression in arteries according to GTEx Portal database analysis .

How should NBEAL1 antibodies be used in immunofluorescence studies?

For immunofluorescence applications, NBEAL1 antibodies are typically used at concentrations of 1-4 μg/ml . When studying subcellular localization, co-staining with Golgi markers such as Giantin (1:500 dilution) is recommended as NBEAL1 has been identified as a Golgi-associated protein . Confocal microscopy is preferable for detailed subcellular localization studies due to NBEAL1's association with specific organelles.

What are the optimal western blotting conditions for NBEAL1 detection?

For western blotting applications:

• Concentration: 0.04-0.4 μg/mL is typically recommended for NBEAL1 antibodies

• Sample preparation: Complete lysis buffers containing protease inhibitors are essential

• Controls: Positive controls should include tissues with high NBEAL1 expression (arterial tissues)

• Detection: Due to multiple NBEAL1 isoforms observed in various cell lines (HeLa, HEK-293T, HUVECs) , researchers should be prepared to detect several bands

Table 1: Recommended Applications and Dilutions for NBEAL1 Antibodies

How can NBEAL1 antibodies facilitate studies of cholesterol metabolism?

NBEAL1 antibodies are valuable tools for investigating cholesterol metabolism pathways through several methodological approaches:

• Co-immunoprecipitation studies: NBEAL1 antibodies can be used to pull down protein complexes to study NBEAL1's interactions with SREBP2, SCAP, and PAQR3, which are critical for understanding its role in cholesterol metabolism regulation .

• Cholesterol transport visualization: Combined with cholesterol markers and LDLR antibodies, NBEAL1 antibodies can help visualize the spatial relationships between NBEAL1 and cholesterol transport machinery.

• SREBP2 processing analysis: NBEAL1 antibodies can be employed in studies examining SREBP2 cleavage and nuclear translocation, as NBEAL1 has been shown to modulate SREBP2 activity and processing .

These applications are particularly relevant in cardiovascular research, as genetic variants in NBEAL1 are associated with increased risk of coronary artery disease .

What approaches can be used for NBEAL1 detection in glioma research?

NBEAL1 has been confirmed to be overexpressed in stage I glioma, making NBEAL1 antibodies potentially valuable tools in glioma research . Researchers have developed innovative approaches for NBEAL1 detection in glioma:

• Quantum dot conjugated antibodies: Anti-NBEAL1 antibodies conjugated with CdTe quantum dots have been successfully used for in vivo imaging of glioma in mouse models. These nanoprobes, when injected into mice via tail vessel, were clearly observable in brain tissues of glioma mouse models after 12 hours using IVIS Imaging systems .

• Tissue microarray analysis: NBEAL1 antibodies can be applied to glioma tissue microarrays to evaluate expression patterns across different glioma grades and correlate with patient outcomes.

• Single-cell analysis: Combined with other markers, NBEAL1 antibodies may help identify specific cell populations within heterogeneous glioma tissues.

How can NBEAL1 antibodies be used in arterial disease models?

Given NBEAL1's highest expression in arteries and its association with coronary artery disease risk, NBEAL1 antibodies are particularly valuable in arterial disease research:

• Atherosclerotic plaque analysis: NBEAL1 antibodies can be used to examine NBEAL1 expression in atherosclerotic plaques and correlate with disease progression.

• Primary endothelial cell studies: In human umbilical vein endothelial cells (HUVECs), NBEAL1 antibodies can help investigate the relationship between NBEAL1 expression and endothelial cell function, including expression of adhesion molecules following inflammatory stimuli .

• Genetic model validation: In studies of NBEAL1 knockdown or knockout models, NBEAL1 antibodies provide essential validation of altered protein expression.

Why might researchers encounter difficulties with commercial NBEAL1 antibodies?

Research groups have reported challenges with commercial NBEAL1 antibodies, with some noting that "No commercial antibodies exist for NBEAL1" or that despite several attempts, they "failed to generate specific NBEAL1 antibodies" . These difficulties may stem from:

• Multiple NBEAL1 isoforms present in different cell lines, making detection complex

• Potential post-translational modifications affecting epitope accessibility

• Low endogenous expression levels in many cell types

• Cross-reactivity with other BEACH domain-containing proteins

When encountering such challenges, researchers might consider alternative approaches like epitope tagging of NBEAL1 (e.g., EGFP-NBEAL1) for detection and localization studies .

What controls are essential when using NBEAL1 antibodies?

When using NBEAL1 antibodies, the following controls are essential:

• Positive tissue controls: Arterial tissue samples should be included as positive controls due to NBEAL1's highest expression in arteries .

• Negative controls: Include tissues with minimal NBEAL1 expression or use appropriate isotype controls.

• Knockdown/knockout validation: When possible, NBEAL1-depleted cells should be used to confirm antibody specificity.

• Competing peptide controls: Pre-incubation of the antibody with the immunizing peptide should abolish specific staining.

• Cross-validation: When feasible, validate findings using multiple antibodies targeting different NBEAL1 epitopes.

How can researchers optimize NBEAL1 detection in challenging samples?

For challenging samples where NBEAL1 detection is difficult:

• Signal amplification systems: Consider tyramide signal amplification or polymer-based detection systems to enhance sensitivity.

• Antigen retrieval optimization: Test multiple antigen retrieval methods (heat-induced vs. enzymatic) and different buffer conditions.

• Fresh vs. fixed samples: For some applications, fresh or freshly frozen samples may yield better results than formalin-fixed tissues.

• Recombinant expression systems: As demonstrated in some studies, creating stable inducible expression of tagged NBEAL1 (e.g., EGFP-NBEAL1 in T-Rex-Flp-In doxycycline-inducible U2OS, HEK-293T, and HeLa cells) can facilitate detection and localization studies .

How might NBEAL1 antibodies contribute to cardiovascular disease biomarker discovery?

Given the association between NBEAL1 genetic variants and coronary artery disease , NBEAL1 antibodies could facilitate biomarker development through:

• Screening arterial tissue samples from patients with different genetic variants to correlate NBEAL1 protein expression with disease progression

• Developing immunoassays for NBEAL1 in plasma or serum to evaluate its potential as a circulating biomarker

• Investigating NBEAL1's relationship with established cardiovascular biomarkers

Such approaches may provide early diagnosis for individuals at risk for coronary artery disease, as suggested by researchers who noted that "characterization of NBEAL1 as a novel player involved in regulation of cholesterol homeostasis may provide early diagnosis of persons at risk" .

What emerging techniques could enhance NBEAL1 antibody applications?

Several emerging techniques could significantly enhance NBEAL1 antibody applications:

• Proximity ligation assays: For detecting and quantifying NBEAL1 interactions with SCAP, PAQR3, and SREBP2 in situ

• Mass spectrometry-based immunoprecipitation: For detailed characterization of NBEAL1 protein complexes in different cellular contexts

• Super-resolution microscopy: For precise subcellular localization of NBEAL1 at the Golgi apparatus and potential colocalization with cholesterol transport machinery

• Quantum dot conjugation: Building on previous work with glioma detection , NBEAL1 antibody conjugation with quantum dots offers promising applications for both imaging and potential therapeutic targeting

What are the most pressing questions in NBEAL1 research that antibodies could help address?

Several critical questions in NBEAL1 research could be addressed using antibodies:

• What is the functional significance of different NBEAL1 isoforms observed across cell types?

• How does NBEAL1 localization change in response to altered cholesterol levels or inflammatory stimuli?

• What are the precise mechanisms by which NBEAL1 regulates SREBP2 processing?

• How do NBEAL1 genetic variants associated with coronary artery disease affect protein expression and function at the cellular level?

• Is NBEAL1 overexpression in glioma functionally important for tumor progression, and could it serve as a therapeutic target?

The characterization of NBEAL1 knockout mice, as suggested by researchers , would be particularly valuable for understanding NBEAL1's physiological role, with antibodies being essential tools for validating these models.