nme6 Antibody

What are the different isoforms of NME6 and how can antibodies detect them?

NME6 exists in two distinct isoforms in humans: a 194 amino acid (aa) long isoform and a 186 aa short isoform. When conducting research using NME6 antibodies, it's important to understand which isoform(s) your antibody can detect.

Western blot analysis reveals that the shorter NME6-186 isoform is predominantly expressed in human cells, although mass spectrometry has detected both endogenous NME6-194 and NME6-186 in HeLa and MDA-MB-231T cells . When selecting an antibody for NME6 detection, consider the following:

• If both isoforms need to be detected separately, ensure the antibody can distinguish between them based on molecular weight (the two isoforms migrate differently on Western blots, with the 194 aa isoform appearing slightly above 20 kDa and the 186 aa isoform slightly below 20 kDa)

• For experiments requiring isoform-specific detection, validate your antibody against recombinant proteins of both isoforms to confirm specificity

• Commercial antibodies like HPA017909 can detect human NME6 in multiple applications including immunohistochemistry and Western blotting

What is the subcellular localization of NME6 and how should this inform antibody-based detection methods?

NME6 primarily localizes to the mitochondria, specifically to the mitochondrial inner membrane (MIM) and the matrix space . This subcellular localization has important implications for antibody-based detection approaches:

• For immunofluorescence studies, mitochondrial co-staining markers should be used alongside NME6 antibodies to confirm mitochondrial localization

• Cell fractionation protocols should include mitochondrial isolation steps when preparing samples for Western blot analysis of NME6

• When performing immunohistochemistry, tissue samples with high mitochondrial content (like cardiac and skeletal muscle) may show stronger NME6 signal

• Permeabilization conditions should be optimized to ensure antibody access to mitochondrial compartments while maintaining structural integrity

When using antibodies for detecting NME6, it's recommended to use concentrations of 0.25-2 μg/mL for immunofluorescence and dilutions of 1:200-1:500 for immunohistochemistry applications .

How ubiquitous is NME6 expression across human tissues and cell lines?

NME6 demonstrates widespread expression across human tissues and cell lines, making it an accessible target for research in various biological contexts.

When designing experiments:

• Include appropriate positive controls from cell lines known to express NME6 (such as MDA-MB-231T, which has been extensively used as a model system for NME studies)

• Consider normalizing NME6 expression to housekeeping proteins when comparing expression across different tissues or experimental conditions

• Be aware that tight regulation of endogenous NME6 expression has been observed, where knock-in of FLAG-tagged NME6 resulted in decreased expression of endogenous NME6

How can researchers effectively study NME6's role in mitochondrial ribonucleotide synthesis using antibody-based approaches?

Recent research has revealed that NME6 plays a critical role in supplying mitochondria with pyrimidine ribonucleotides essential for mitochondrial gene transcription . To study this function using antibody-based approaches:

• Combined knockdown/knockout studies: Design experiments that combine NME6 antibody detection with genetic manipulation approaches:

  • Use CRISPR/Cas9 to generate NME6 knockout cell lines and confirm deletion using Western blotting with NME6 antibodies

  • Compare mtDNA levels by qPCR between wild-type and NME6 knockout cells under normal conditions and when pyrimidine carriers (SLC25A33 and SLC25A36) are depleted

  • Validate rescue experiments with wild-type NME6 vs. kinase-inactive mutant NME6 (H137N) using antibody detection

• Mitochondrial function assessment:

  • Use NME6 antibodies alongside antibodies for mitochondrial-encoded proteins (e.g., MT-CO2) to correlate NME6 expression with OXPHOS complex abundance

  • Combine immunoblotting for OXPHOS subunits with respirometry measurements to assess functional consequences of NME6 manipulation

• Nucleotide supplementation experiments:

  • After confirming NME6 knockout/knockdown by antibody detection, supplement cells with rNTPs, dNTPs, or nucleosides and measure mitochondrial transcript levels and OXPHOS subunit abundance

  • This approach helps distinguish between NME6's roles in providing nucleotides for mtDNA maintenance versus transcription

What methodological approaches can resolve the apparent contradictions in NME6 phosphotransfer activity?

The literature contains some contradictory findings regarding NME6's enzymatic activity. While NME6 belongs to the nucleoside diphosphate kinase family, some studies indicate it is "phosphotransfer-inactive" while others show it "catalyses phosphotransfer through a conserved histidine residue" . Resolving these contradictions requires careful methodological approaches:

• In vitro enzymatic activity assays:

  • Perform coupled enzyme assays using recombinant NME6 proteins (both isoforms) and compare with positive controls (e.g., NME1)

  • Compare enzymatic activities under varying conditions (pH, temperature, cofactors) that might explain discrepancies

• Phosphorylated histidine detection:

  • Western blot under phosphohistidine-preserving and non-preserving conditions using antibodies that can detect 1-pHis and 3-pHis

  • Compare phosphohistidine patterns between NME6 and other NME family members with known activity

• Structure-function analysis:

  • Generate point mutations in the conserved H137 residue (e.g., H137N) and test functionality in cellular complementation assays

  • Use antibodies to detect expression levels while measuring functional outcomes like mtDNA maintenance and OXPHOS subunit expression

• Substrate specificity characterization:

  • Test NME6 activity with different nucleotide substrates focusing on pyrimidine nucleotides

  • Combine with metabolic labeling and mass spectrometry to track phosphate transfer in cellular contexts

How can researchers effectively study NME6 protein interactions in mitochondria?

Understanding NME6's protein interactions is crucial for elucidating its functions in mitochondria. Studies have shown that NME6 does not form homo-oligomers or hetero-oligomers with Group I NME members , but interacts with mitochondrial proteins:

• Co-immunoprecipitation strategies:

  • Use anti-NME6 antibodies for immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Perform reciprocal IPs and validate interactions with Western blotting

  • RCC1L (WBSCR16) has been identified as a high-confidence interaction partner of NME6

• Proximity labeling approaches:

  • Generate NME6 fusion proteins with proximity labeling enzymes (BioID, APEX)

  • Use antibodies to confirm expression and localization before proximity labeling

  • Identify labeled proteins using mass spectrometry and validate with co-IP

• Functional validation of interactions:

  • After identifying interaction partners, design siRNA knockdown or CRISPR knockout experiments targeting these partners

  • Use NME6 antibodies to assess whether NME6 stability, localization, or function is affected

  • For interactions with mitoribosome assembly factors like RCC1L, assess effects on mitochondrial protein synthesis and transcript levels

What are the recommended controls and validation steps for NME6 antibody specificity?

Ensuring antibody specificity is crucial for obtaining reliable results in NME6 research. Based on published approaches, the following validation strategies are recommended:

• Genetic knockout controls:

  • Generate CRISPR/Cas9 NME6 knockout cell lines to serve as negative controls

  • Compare antibody signal between wild-type and knockout cells in Western blots and immunostaining

• Recombinant protein controls:

  • Use purified recombinant NME6 proteins (both 194 aa and 186 aa isoforms) as positive controls

  • Compare migration patterns with endogenous NME6 after partial thrombin-cleavage of His-tag residue

• Overexpression systems:

  • Generate stable clones overexpressing tagged NME6 variants (e.g., NME6-194-FLAG and NME6-186-FLAG)

  • Verify antibody detection of both endogenous and overexpressed proteins

• Mass spectrometry confirmation:

  • Perform immunoprecipitation with anti-NME6 antibodies followed by mass spectrometry

  • Confirm the presence of NME6-specific peptides in the precipitated material

• Peptide competition assays:

  • Pre-incubate NME6 antibody with the immunogen peptide (sequence: DAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA)

  • Verify loss of signal in Western blots or immunostaining

How can researchers optimize detection protocols for low abundance NME6 in different experimental contexts?

NME6 expression can vary across cell types and may be tightly regulated, presenting challenges for detection in some experimental contexts:

• Sample preparation optimization:

  • For mitochondrial proteins like NME6, enrichment through mitochondrial isolation can improve detection sensitivity

  • Use protease inhibitors that protect against both cytosolic and mitochondrial proteases

  • Consider phosphatase inhibitors when studying potential phosphorylation states of NME6

• Signal amplification strategies:

  • For immunohistochemistry and immunofluorescence, employ tyramide signal amplification or similar methods

  • For Western blotting of low abundance samples, use high-sensitivity ECL substrates or fluorescent secondary antibodies

  • For immunoprecipitation, optimize antibody concentration and binding conditions

• Antibody selection and application-specific considerations:

  • For immunofluorescence, use higher antibody concentrations (0.25-2 μg/mL) with extended incubation times

  • For Western blotting, consider transfer conditions optimized for smaller proteins (15-25 kDa range)

  • For immunohistochemistry, dilutions of 1:200-1:500 are recommended

• Expression manipulation strategies:

  • Be aware that overexpression of tagged NME6 may suppress endogenous NME6 expression

  • When using knockdown approaches, optimize siRNA conditions to ensure sufficient depletion for observable phenotypes

How can researchers distinguish between NME6's roles in mtDNA maintenance versus mitochondrial transcription?

NME6 has dual roles in mitochondrial function, contributing to both mtDNA maintenance and mitochondrial transcription. Distinguishing between these functions requires specific experimental approaches:

• Differential nucleotide supplementation:

  • Supplement NME6 knockout cells with either rNTPs (for transcription) or dNTPs (for replication)

  • Measure mitochondrial transcript levels by qPCR and OXPHOS subunit abundance by immunoblotting

  • rNTP supplementation specifically rescues mitochondrial transcript levels in NME6 knockout cells, while having no effect on mtDNA content

• Combined genetic approaches:

  • Generate cell lines with NME6 knockout alone or in combination with pyrimidine carrier knockouts (SLC25A33 and SLC25A36)

  • NME6 knockout alone doesn't affect mtDNA levels, but combined deletion with pyrimidine carriers causes dramatic mtDNA loss

  • This approach separates NME6's role in standard conditions versus when cytosolic nucleotide supply is limited

• Structure-function analysis with H137N mutant:

  • Express wild-type NME6 or kinase-inactive H137N mutant in knockout cells

  • Only wild-type NME6 rescues mtDNA maintenance in cells lacking pyrimidine carriers

  • This confirms the requirement for NME6's kinase activity in its functions

• Temporal analysis of effects:

  • Monitor transcription changes and mtDNA depletion after acute NME6 depletion

  • Determine which effect occurs first to identify the primary function

What methodological approaches can assess the impact of NME6 on OXPHOS function?

NME6 loss affects OXPHOS subunit abundance and function, which can be assessed using several complementary approaches:

How should researchers interpret data from NME6 studies in different cancer cell lines?

NME6 research has been conducted across multiple cancer cell lines, with varying effects observed depending on the cellular context:

• Cell line selection considerations:

  • MDA-MB-231T cells have been extensively used as a model system for NME studies

  • Different liver cancer cell lines (HLE, Huh6, HepG2) show varying dependencies on NME6 for growth

  • Include multiple cell lines in studies to determine the generalizability of findings

• Correlation analysis approaches:

  • Correlate NME6 dependency with OXPHOS subunit levels across cell lines

  • Growth defects upon NME6 loss correlate with OXPHOS subunit abundance in different cell lines

  • Use public CRISPR screening databases (e.g., DepMap) to identify other cell lines with strong NME6 dependency

• Genetic interaction analysis:

  • Use gene coessentiality network analysis across cancer cell lines

  • FIREWORKS analysis shows that top coessential genetic interactors with NME6 are regulators of mtDNA replication, transcription, and mitoribosome biogenesis

  • This network approach helps place NME6 in its broader functional context

• Metabolic context consideration:

  • Interpret NME6 effects in light of the metabolic profile of each cell line

  • Differences in pyrimidine nucleotide metabolism or dependence on OXPHOS may explain variable NME6 requirements

  • Consider measuring nucleotide pools and mitochondrial respiration alongside NME6 expression