gem6 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to GEMIN6 Antibody

The GEMIN6 antibody is a polyclonal antibody developed against the GEMIN6 protein, a component of the survival of motor neuron (SMN) complex. This complex plays a critical role in small nuclear ribonucleoprotein (snRNP) assembly, essential for pre-mRNA splicing. The GEMIN6 antibody is primarily utilized in research applications such as Western blotting and immunohistochemistry to study the expression and localization of the GEMIN6 protein in cellular and tissue contexts .

Antigen Specificity and Development

The GEMIN6 antibody targets a recombinant protein corresponding to the amino acid sequence:
MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSS
This sequence spans key functional domains of the GEMIN6 protein, enabling precise detection in experimental settings .

Immunohistochemical Localization

In paraffin-embedded tissues, the GEMIN6 antibody has been used to map protein expression patterns, particularly in neural and muscular tissues, aligning with the SMN complex’s role in spinal muscular atrophy (SMA) .

Limitations and Future Directions

Current literature on GEMIN6 antibodies remains sparse, with no peer-reviewed studies directly cited in the provided sources. Further research is needed to:

  • Characterize GEMIN6’s interactions within the SMN complex.

  • Explore therapeutic implications in SMA or other spliceosome-related disorders.

  • Validate cross-reactivity and specificity across species .

Product Specs

Buffer
**Preservative:** 0.03% Proclin 300
**Constituents:** 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
new12 antibody; SPAC4D7.15 antibody; Uncharacterized protein new12 antibody
Target Names
gem6
Uniprot No.

Target Background

Function
The SMN complex is essential for the assembly of small nuclear ribonucleoproteins (snRNPs), which are fundamental components of the spliceosome. This complex plays a crucial role in the splicing of cellular pre-messenger RNA (pre-mRNA). Most spliceosomal snRNPs contain a common set of Sm proteins: smb1, smd1, smd2, smd3, sme1, smf1, and smg1. These proteins assemble into a heptameric protein ring on the Sm site of the small nuclear RNA (snRNA), forming the core snRNP (Sm core). In the cytosol, the Sm proteins smd1, smd2, sme1, smf1, and smg1 (5Sm) are held inactive in a 6S pICln-Sm complex by the chaperone protein saf5. The SMN complex facilitates the assembly of core snRNPs by accepting 5Sm from saf5. The binding of snRNA within 5Sm triggers the release of the SMN complex, enabling the subsequent binding of smd3 and smb1 to complete the assembly of the core snRNP.
Database Links

Q&A

What is GEMIN6 and why is it important in biological research?

GEMIN6 is part of a large macromolecular complex, serving as a functional component of the SMN (Survival Motor Neuron) complex involved in the assembly of small nuclear ribonucleoproteins (snRNPs). This 18.8 kDa protein plays essential roles in RNA processing pathways and has been implicated in neuromuscular disease mechanisms. Understanding GEMIN6 function has significance for both basic molecular biology research and potential therapeutic applications in neurodegenerative disorders . The study of GEMIN6 requires specific antibodies that can reliably detect and isolate this protein from complex biological samples.

What types of GEMIN6 antibodies are currently available for research?

There are several validated antibodies available for GEMIN6 research, including:

Antibody TypeClone/IDHost SpeciesApplicationsSpecies Reactivity
MonoclonalGEM6E(8A9)MouseIF, WBHuman
Monoclonal3D2MouseELISA, WBHuman
PolyclonalHPA035726RabbitIHCHuman

These antibodies vary in their applications and specificity, making selection important based on experimental needs . The monoclonal antibodies tend to offer higher specificity, while polyclonal antibodies may provide greater sensitivity for certain applications.

How should GEMIN6 antibodies be stored and handled to maintain activity?

For optimal performance, GEMIN6 antibodies should be stored according to manufacturer recommendations. Short-term storage at 4°C (up to two weeks) is suitable for immediate use, while long-term storage requires dividing the solution into small aliquots (no less than 20 μl) and freezing at -20°C or -80°C. Repeated freeze-thaw cycles significantly reduce antibody activity and should be avoided . For concentrated products, a stabilizing protein (such as BSA) may be added to prevent adsorption to containers. Proper handling includes avoiding contamination and maintaining sterility whenever possible.

What are the optimal dilutions for GEMIN6 antibodies in different applications?

The optimal working dilutions vary by application and specific antibody:

ApplicationRecommended Dilution RangeOptimization Notes
Western Blot1:500 - 1:2000Start with 1:1000; adjust based on signal intensity
Immunofluorescence1:100 - 1:500Cell type and fixation method affect optimal dilution
Immunohistochemistry1:50 - 1:200Tissue-specific optimization required
ELISA1:1000 - 1:5000Significant variation between antibody lots may occur

These ranges are starting points; empirical optimization is essential for each specific experimental system . A dilution series should be performed when using a new lot or in a new experimental context.

How should I select between monoclonal and polyclonal GEMIN6 antibodies for my research?

The choice between monoclonal (e.g., GEM6E(8A9)) and polyclonal anti-GEMIN6 antibodies depends on your experimental goals:

  • Monoclonal antibodies offer higher specificity by recognizing a single epitope, making them ideal for experiments requiring precise detection of GEMIN6 without cross-reactivity. The GEM6E(8A9) monoclonal antibody was raised against full-length GEMIN6 recombinant protein and has been validated for Western blot and immunofluorescence applications in human samples .

  • Polyclonal antibodies recognize multiple epitopes, potentially providing higher sensitivity and greater tolerance to protein denaturation. They're particularly useful for applications like immunoprecipitation where antigen capture efficiency is paramount .

For co-localization studies or when examining protein-protein interactions, monoclonal antibodies may be preferable to ensure specificity. For detection of low-abundance GEMIN6 in tissue samples, polyclonal antibodies might provide better sensitivity.

What controls should be included when using GEMIN6 antibodies?

Rigorous experimental design requires appropriate controls:

  • Positive controls: Cell lines or tissues known to express GEMIN6 (e.g., HeLa cells)

  • Negative controls:

    • Primary antibody omission

    • Samples from GEMIN6 knockout systems

    • Isotype controls matching the GEMIN6 antibody class

  • Peptide competition: Pre-incubation of antibody with immunizing peptide should abolish specific signal

  • Cross-validation: Using two different GEMIN6 antibodies that recognize different epitopes

These controls help distinguish specific from non-specific signals and validate antibody performance in each experimental context .

What are common issues with Western blot detection of GEMIN6 and how can they be resolved?

When performing Western blot with GEMIN6 antibodies, researchers may encounter several challenges:

IssuePossible CausesSolutions
No signalInsufficient protein, inactive antibody, improper transferIncrease protein loading (20-50μg total protein), verify transfer with reversible stain, test antibody with positive control
Multiple bandsNon-specific binding, protein degradation, post-translational modificationsIncrease blocking time/concentration, add 0.1% SDS to antibody dilution, include protease inhibitors in sample preparation
High backgroundInsufficient blocking, excessive antibody concentrationIncrease blocking time to 2 hours, optimize antibody dilution, add 0.05% Tween-20 to washing steps
Inconsistent molecular weightPost-translational modifications, alternative splicingCompare with literature values, use purified recombinant GEMIN6 as reference

For the GEM6E(8A9) monoclonal antibody, a 1:1000 dilution in 5% non-fat milk typically provides optimal results with minimal background . Extended washing steps (5×5 minutes) can significantly improve signal-to-noise ratio.

How can I optimize immunofluorescence protocols for GEMIN6 detection?

Successful immunofluorescence detection of GEMIN6 requires attention to several factors:

  • Fixation method: Paraformaldehyde (4%) for 15 minutes preserves epitope accessibility for most GEMIN6 antibodies.

  • Permeabilization: 0.1-0.5% Triton X-100 for 10 minutes is typically sufficient.

  • Blocking: 5% normal serum (matching secondary antibody host) for 1 hour minimizes non-specific binding.

  • Primary antibody incubation: Overnight at 4°C at dilutions of 1:100-1:250 typically yields optimal results.

  • Signal amplification: For low abundance detection, consider tyramide signal amplification systems.

  • Counter-staining: DAPI nuclear stain helps visualize the relationship between GEMIN6 and nuclear structures.

GEMIN6 typically shows punctate nuclear staining pattern corresponding to Gems (Gemini of Cajal bodies) in cells expressing the protein . Optimization may be necessary for different cell types and fixation methods.

How can GEMIN6 antibodies be used to investigate the SMN complex assembly?

For investigating SMN complex assembly and dynamics, researchers can employ several advanced techniques with GEMIN6 antibodies:

  • Co-immunoprecipitation (Co-IP): Using GEMIN6 antibodies to pull down the entire SMN complex allows identification of interacting partners and complex composition changes under different conditions.

  • Proximity Ligation Assay (PLA): This technique can visualize and quantify protein-protein interactions between GEMIN6 and other SMN complex components with nanometer resolution in situ.

  • Chromatin Immunoprecipitation (ChIP): Although GEMIN6 is not directly DNA-binding, ChIP can be used to investigate indirect associations with chromatin through protein complexes.

  • FRAP (Fluorescence Recovery After Photobleaching): When used in conjunction with fluorescently-tagged proteins, anti-GEMIN6 immunofluorescence can help validate FRAP experiments examining SMN complex dynamics.

These approaches have revealed that GEMIN6 functions within a core complex including GEMIN7 and GEMIN8, which is critical for snRNP assembly .

What are the considerations for using GEMIN6 antibodies in mass spectrometry-based proteomics?

When incorporating GEMIN6 antibodies into mass spectrometry workflows:

  • Antibody purity: Ensure high purity to prevent contaminating proteins from overwhelming mass spectrometry analysis.

  • Cross-linking considerations: If using chemical cross-linking, ensure the cross-linker doesn't modify key epitopes recognized by the GEMIN6 antibody.

  • Elution conditions: Harsh elution conditions can introduce modifications that complicate mass spectrometry interpretation. Consider using competitive elution with immunizing peptides.

  • Sample preparation: Following immunoprecipitation with GEMIN6 antibodies, samples require appropriate processing (reduction, alkylation, digestion) optimized for the specific mass spectrometry platform.

  • Data analysis: Use appropriate controls to distinguish true interactors from background proteins commonly identified in immunoprecipitation-mass spectrometry experiments.

This approach has been valuable for identifying novel GEMIN6 interacting partners and characterizing post-translational modifications that regulate SMN complex function .

Which model organisms can be studied using available GEMIN6 antibodies?

Current GEMIN6 antibodies have limited cross-species reactivity:

AntibodyConfirmed ReactivityNot Validated ForNotes
GEM6E(8A9)HumanPig, fish, mouseMost extensively characterized
HPA035726HumanNot specifiedMay require additional validation for other species
WH0079833M8HumanNot specifiedLimited cross-species testing reported

Researchers studying non-human models should note that the GEM6E(8A9) antibody is specifically not validated for pig, fish, or mouse samples according to the depositor notes . This limits the utility of these antibodies in common model organisms and may necessitate generating new antibodies for specific model systems or conducting validation studies before use.

How can I validate a GEMIN6 antibody for use in a species not previously tested?

For extending the use of GEMIN6 antibodies to additional species:

  • Sequence comparison: Compare the epitope region (if known) or full GEMIN6 sequence between human and the target species to predict potential cross-reactivity.

  • Western blot validation: Run parallel samples from human tissues/cells (positive control) and the target species to compare band patterns and molecular weights.

  • Recombinant protein controls: Express the target species' GEMIN6 as a recombinant protein to test antibody recognition.

  • Immunoprecipitation-Mass Spectrometry: Confirm that the protein immunoprecipitated from the new species is indeed GEMIN6 through mass spectrometry analysis.

  • Genetic models: If available, use GEMIN6 knockdown or knockout samples from the target species as negative controls.

This systematic validation approach helps prevent misinterpretation of results when extending antibody use to new species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.