NFKBIB Antibody

What is NFKBIB and what is its role in cellular signaling?

NFKBIB (also known as IKBB or TRIP9) is a 356-amino acid protein that functions as an inhibitor of NF-kappa-B by complexing with and trapping it in the cytoplasm. This protein is localized to both the nucleus and cytoplasm and undergoes phosphorylated post-translational modifications . NFKBIB is encoded by the NFKBIB gene in humans and is expressed ubiquitously across all tissues examined . It serves as a critical regulator of the NF-κB pathway, which plays pivotal roles in immune response, inflammation, cellular proliferation, and apoptosis .

The NF-κB/Rel transcription factors exist in the cytosol in an inactive state, complexed with inhibitory IκB proteins including NFKBIB. When cells receive appropriate stimuli, a signaling cascade leads to phosphorylation of IκB proteins, marking them for ubiquitination and proteasomal degradation. This releases NF-κB, allowing it to translocate to the nucleus and regulate gene expression .

How does NFKBIB differ structurally and functionally from other NF-κB inhibitors?

While all members of the IκB family inhibit NF-κB activity, NFKBIB has distinct structural and functional characteristics:

NFKBIB contains ankyrin repeat domains that mediate protein-protein interactions with NF-κB subunits and has a unique C-terminal region with the sequence "MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV" that contributes to its specific function .

What are the common applications for NFKBIB antibodies in research?

NFKBIB antibodies are utilized in various research applications, with different antibody formats optimized for specific techniques:

Researchers should select antibodies specifically validated for their intended application, as performance can vary significantly across different techniques .

How do phosphorylation states of NFKBIB regulate NF-κB pathway activation?

Phosphorylation of NFKBIB represents a critical regulatory mechanism for NF-κB pathway activation. Specifically:

Phosphorylation at Ser23 of NFKBIB (analogous to Ser32/36 in IκBα) marks the protein for ubiquitination and subsequent proteasomal degradation . This phosphorylation is mediated by the IκB kinase (IKK) complex, which consists of catalytic subunits IKKα and IKKβ and the regulatory subunit IKKγ .

The activation of the IKK complex itself depends on phosphorylation at Ser177 and Ser181 in the activation loop of IKKβ (Ser176 and Ser180 in IKKα), which induces conformational changes resulting in kinase activation . Different stimuli (TNF, IL-1, LPS) can activate this pathway through specific upstream signaling components.

Researchers investigating NFKBIB phosphorylation should consider using phospho-specific antibodies such as anti-NFKBIB (pSer23) for precise detection of this post-translational modification . Phosphorylation status can be monitored in time-course experiments following stimulation to capture the dynamic nature of this regulatory event.

What is the relationship between NFKBIB dysfunction and human diseases?

Dysregulation of NF-κB signaling, including abnormal NFKBIB function, is implicated in various human diseases:

Recent research has revealed connections between the NF-κB pathway and autoimmunity. Patients with specific NF-κB pathway deficiencies (including NIK, RELB, and certain NF-κB2 deficiencies) produce autoantibodies against type I interferons, predisposing them to severe viral infections including life-threatening COVID-19 pneumonia .

Understanding NFKBIB's role in these pathologies requires sophisticated approaches combining genetic analysis, protein expression studies, and functional assays in relevant biological systems.

How does NFKBIB interact with other signaling pathways beyond the canonical NF-κB pathway?

NFKBIB functions within a complex network of interacting signaling pathways:

• PI3K/AKT Pathway: Cross-talk occurs through AKT-mediated phosphorylation of IKK, potentially affecting NFKBIB degradation .

• MAPK Pathway: JNK and p38 can modulate NF-κB activity and potentially influence NFKBIB function .

• JAK-STAT Pathway: Shares transcriptional targets with NF-κB and may compete for co-activators .

• TGF-β Pathway: Often antagonizes NF-κB signaling through multiple mechanisms .

• Wnt Pathway: β-catenin can interact with NF-κB components, potentially affecting NFKBIB-mediated inhibition .

• TLR Signaling: Activates NF-κB through MyD88-dependent and independent mechanisms, leading to NFKBIB phosphorylation and degradation .

These pathway interactions create a highly integrated signaling network. Research investigating these connections would benefit from specialized antibodies targeting both NFKBIB and components of interacting pathways, potentially using techniques like proximity ligation assays to detect specific protein interactions.

What are the critical factors for optimizing Western blot protocols for NFKBIB detection?

For optimal Western blot detection of NFKBIB, researchers should consider:

Sample Preparation:

• Include both cytoplasmic and nuclear fractions, as NFKBIB localizes to both compartments .

• Use protease inhibitors to prevent degradation and phosphatase inhibitors when studying phosphorylated forms.

• Stimulation experiments should include appropriate time points (typically 0-120 minutes) to capture phosphorylation and degradation dynamics.

Electrophoresis and Transfer:

• NFKBIB has an expected molecular weight of approximately 35-40 kDa.

• Standard SDS-PAGE (10-12% gels) is typically suitable.

• Use wet transfer for optimal protein transfer.

Antibody Selection and Dilution:

• Primary antibody dilutions vary by product (typically 1:500-1:2000).

• For phospho-specific detection, anti-NFKBIB (pSer23) antibodies are available .

• Validated antibodies include rabbit polyclonal and mouse monoclonal options targeting different epitopes .

Controls:

• Positive control: Cell lysates known to express NFKBIB (ubiquitously expressed).

• Negative control: NFKBIB knockdown/knockout samples.

• Phosphorylation controls: Samples treated with phosphatase or kinase inhibitors.

Representative researchers report best results using rabbit polyclonal antibodies at 1:1000 dilution with overnight incubation at 4°C, followed by appropriate HRP-conjugated secondary antibodies .

What strategies can researchers use to distinguish between NFKBIB and other IκB family proteins?

Distinguishing between NFKBIB and other IκB family proteins requires careful experimental design:

For NFKBIB-specific detection, antibodies targeting the C-terminal region (e.g., "MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV") offer the highest specificity as this sequence has lower homology with other IκB proteins . Several commercially available antibodies specifically recognize the C-terminal or internal regions of NFKBIB with validated specificity .

How should researchers approach species cross-reactivity when using NFKBIB antibodies?

NFKBIB is relatively well-conserved across species, but important considerations for cross-species applications include:

Sequence Homology Analysis:
Human NFKBIB shares 82% and 80% amino acid sequence identity with mouse and rat NFKBIB, respectively . This relatively high conservation suggests potential cross-reactivity, confirmed by the availability of antibodies reactive with multiple species.

Available Cross-Reactive Antibodies:
Several antibodies demonstrate validated cross-reactivity with predicted reactivity percentages: Cow: 91%, Dog: 83%, Guinea Pig: 92%, Horse: 92%, Human: 100%, Mouse: 85%, Rabbit: 77%, Rat: 92% .

Epitope Selection Considerations:
Antibodies targeting highly conserved regions offer greater cross-species reactivity. The central domain of NFKBIB (particularly amino acids 56-237) is more conserved than terminal regions .

Experimental Validation Requirements:
Even with predicted cross-reactivity, researchers should perform their own validation in each species and application. Include appropriate positive controls from the species being studied and consider Western blot to confirm the expected molecular weight, which may vary slightly between species.

For maximal cross-species flexibility, consider rabbit polyclonal antibodies raised against conserved regions, such as those targeting amino acids 56-237 of human NFKBIB .

What are the common sources of false positives and negatives when using NFKBIB antibodies?

When working with NFKBIB antibodies, researchers should be aware of several potential sources of inaccurate results:

False Positives:

• Cross-reactivity with other IκB family members (particularly NFKBIA/IκBα) due to sequence homology.

• Non-specific binding to abundant proteins of similar molecular weight.

• Inadequate blocking leading to high background signal.

• Secondary antibody cross-reactivity, especially when using multiple primary antibodies.

• Sample overloading causing non-specific bands.

False Negatives:

• Epitope masking due to protein-protein interactions or post-translational modifications.

• Protein degradation during sample preparation, particularly important for phosphorylated forms.

• Insufficient antigen retrieval in fixed tissues (especially for IHC applications).

• Antibody concentrations below detection threshold.

• Improper subcellular fractionation (NFKBIB is present in both cytoplasm and nucleus).

Application-Specific Issues:

• Western Blot: Inefficient transfer of proteins to membrane, particularly for certain molecular weights.

• IHC/IF: Overfixation masking epitopes or high autofluorescence interfering with signal detection.

• IP: Weak or transient protein interactions disrupted during washing steps.

To minimize these issues, researchers should validate antibodies using multiple techniques, include appropriate controls, and optimize protocols for their specific experimental system .

What validation strategies should researchers employ when using NFKBIB antibodies in a new experimental system?

When implementing NFKBIB antibodies in a new experimental system, comprehensive validation is essential:

For phospho-specific antibodies, additional validation should include:

• Phosphatase treatment of samples (should eliminate signal)

• Kinase inhibitor pre-treatment (should reduce signal after stimulation)

• Time-course experiments showing expected phosphorylation dynamics

Researchers report highest confidence in results when validating with at least three independent approaches, particularly combining genetic modulation (knockdown) with biochemical validation (peptide competition) and functional assessment (stimulation response) .

How can researchers accurately quantify NFKBIB levels and activation state in complex biological samples?

Accurate quantification of NFKBIB requires sophisticated approaches depending on the specific research question:

For Total NFKBIB Quantification:

• Western blot with densitometry (semi-quantitative) using recombinant protein standards.

• ELISA assays using validated NFKBIB antibody pairs for higher precision.

• Mass spectrometry-based proteomics for absolute quantification and isoform discrimination.

For Phosphorylated NFKBIB:

• Phospho-specific antibodies (e.g., anti-pSer23 NFKBIB) with appropriate controls.

• Phos-tag SDS-PAGE to separate phosphorylated from non-phosphorylated forms.

• Phosphoproteomic analysis for site-specific quantification.

For Subcellular Distribution:

• Subcellular fractionation followed by Western blot with compartment-specific markers.

• Quantitative immunofluorescence with digital image analysis.

• Proximity ligation assays to detect NFKBIB-NF-κB interactions in specific compartments.

For Complex Samples (Tissues/Heterogeneous Cell Populations):

• Single-cell analysis techniques (flow cytometry, mass cytometry, single-cell proteomics).

• Spatial proteomics approaches for tissue sections.

• Cell type-specific isolation before analysis.

To ensure accuracy, researchers should:

• Include calibration standards where possible

• Normalize to appropriate housekeeping controls

• Validate findings using orthogonal methods

• Consider both absolute levels and relative changes in experimental contexts

How should researchers interpret NFKBIB data in the context of broader NF-κB pathway dynamics?

Interpreting NFKBIB data requires consideration of its role within the complex and dynamic NF-κB signaling network:

Temporal Context:
The NF-κB pathway has distinct temporal phases. Early phase (minutes to hours) typically shows NFKBIB phosphorylation followed by degradation, while later phases (hours to days) may show NFKBIB resynthesis. Time-course experiments are essential for proper interpretation .

Pathway Integration:
NFKBIB functions within a network including other IκB proteins, IKK complexes, and NF-κB dimers. Changes in NFKBIB should be interpreted alongside other pathway components:

• IKK activation (phosphorylation at Ser177/181)

• NF-κB nuclear translocation

• Target gene expression

Stimulus Specificity:
Different stimuli (TNF, IL-1, TLR ligands) activate the pathway through distinct mechanisms, potentially causing different phosphorylation patterns and degradation kinetics of NFKBIB .

Cell Type Considerations:
NF-κB signaling varies between cell types. NFKBIB may have different baseline levels, localization patterns, and degradation kinetics depending on cellular context.

Disease Relevance:
In pathological contexts (cancer, inflammation, autoimmune conditions), altered NFKBIB function may represent either a causal mechanism or a compensatory response. This distinction requires careful experimental design incorporating gain/loss-of-function approaches .

For comprehensive pathway analysis, researchers should combine NFKBIB assessments with measurements of upstream regulators (IKK activation), parallel components (other IκB proteins), and downstream effects (NF-κB nuclear localization and target gene expression) .