NFYB8 Antibody

What is NFYB8 and what is its functional significance in plant biology?

NFYB8 (Nuclear transcription factor Y subunit B-8; AtNF-YB-8) is encoded by the gene NFYB8 (At2g37060) in Arabidopsis thaliana. It functions as a transcription factor subunit with a protein length of 173 amino acids . The protein contains specific regions that can be targeted by different antibodies, including N-terminus, C-terminus, and mid-section sequences. As part of the NF-Y transcription factor family, it plays important roles in regulating gene expression in plants, particularly in developmental processes and stress responses.

The full sequence of the NFYB8 protein is: MAESQAKSPGGCGSHESGGDQSPRSLHVREQDRFLPIANISRIMKRGLPANGKIAKDAKEIVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYMEPLKVYLMRYREMEGDTKGSAKGGDPNAKKDGQSSQNGQFSQLAHQGPYGNSQAQQHMMVPMPGTD . Understanding this sequence is crucial for verifying antibody specificity and designing proper control experiments.

What types of NFYB8 antibodies are available for plant molecular research?

According to available information, researchers can access several types of NFYB8 antibodies targeting different regions of the protein:

• N-terminus antibodies (X-Q8VYK4-N): A combination of mouse monoclonal antibodies targeting the N-terminal sequence of NFYB8, based on 3 synthetic peptides from this region .

• C-terminus antibodies (X-Q8VYK4-C): Mouse monoclonal antibodies directed against the C-terminal sequence, derived from 3 synthetic peptides representing this region .

• Mid-section antibodies (X-Q8VYK4-M): Monoclonal antibodies that target non-terminus (middle) sequences of the protein, also based on 3 synthetic peptides .

Each antibody combination has demonstrated high ELISA titers (approximately 10,000), suggesting sensitivity capable of detecting approximately 1 ng of target protein on Western blots .

What are the validated applications for NFYB8 antibodies?

Based on documented testing, NFYB8 antibodies have been validated primarily for:

• ELISA (Enzyme-Linked Immunosorbent Assay): All available NFYB8 antibody combinations have demonstrated high titers in ELISA applications, with sensitivity down to approximately 1 ng of target protein .

• Western Blot (WB): While specific validation data for NFYB8 is limited, the antibodies are expected to perform in Western blot applications with similar sensitivity to their ELISA performance .

For researchers planning to use these antibodies in other applications such as immunohistochemistry, immunofluorescence, or chromatin immunoprecipitation, preliminary validation experiments should be conducted, as these applications are not explicitly confirmed in the available documentation.

How should researchers design proper controls for NFYB8 antibody experiments?

When designing controls for NFYB8 antibody experiments, researchers should consider:

• Positive controls: Include samples known to express NFYB8, such as specific Arabidopsis tissues or developmental stages where NFYB8 expression is well-documented.

• Negative controls: Use samples from knockout or knockdown plants where NFYB8 expression is absent or significantly reduced.

• Blocking peptide controls: When available, use the synthetic peptides used to generate the antibodies to block specific binding and confirm signal specificity.

• Isotype controls: Include appropriate isotype control antibodies to distinguish non-specific binding from specific signals.

• Cross-reactivity assessment: Test antibodies against related NF-Y family members to ensure specificity, particularly when studying multiple NF-Y proteins simultaneously.

Similar approaches are used in other antibody validation protocols, such as those for detecting transcription factors like NF-κB, where specificity is critical for accurate experimental outcomes .

What methodological approaches can improve NFYB8 detection sensitivity in plant samples?

To enhance detection sensitivity when working with NFYB8 antibodies:

• Signal amplification techniques: Consider using biotin-streptavidin systems or tyramide signal amplification to enhance weak signals, particularly in tissues with low NFYB8 expression.

• Sample enrichment: For complex plant samples, consider nuclear fractionation to enrich for transcription factors before immunoblotting or immunoprecipitation.

• Optimized extraction buffers: Use buffers containing appropriate protease inhibitors and phosphatase inhibitors if studying post-translational modifications of NFYB8.

• Denaturation conditions: Test different sample preparation methods, as transcription factors may require specific denaturation conditions for optimal epitope exposure.

• Antibody combinations: Consider using a combination of antibodies targeting different regions of NFYB8 to increase detection probability, particularly when protein conformation may mask certain epitopes.

Achieving optimal sensitivity often requires method optimization specific to each experimental system, similar to approaches used for other challenging transcription factors .

How can epitope mapping be performed to validate NFYB8 antibody specificity?

For rigorous validation of NFYB8 antibody specificity through epitope mapping:

• Peptide array analysis: Synthesize overlapping peptides (typically 15-20 amino acids with 5-amino acid overlaps) spanning the entire NFYB8 sequence. Screen the antibodies against these peptides to identify specific binding regions.

• Deletion mutant analysis: Create a series of truncated NFYB8 proteins and test antibody binding to narrow down the essential epitope regions.

• Epitope competition assays: Use synthetic peptides corresponding to predicted epitopes in competition assays to confirm specific binding.

• Alanine scanning mutagenesis: For precise epitope characterization, introduce systematic alanine substitutions within the predicted epitope region to identify critical amino acid residues for antibody recognition.

• Cross-species conservation analysis: Compare epitope sequences across plant species to predict cross-reactivity potential with NFYB8 homologs.

The documented NFYB8 antibodies are already based on specific synthetic peptides targeting distinct regions (N-terminus, C-terminus, or middle section) , which provides initial information about their binding domains.

What are the considerations for optimizing NFYB8 antibody performance in Western blot applications?

For optimal Western blot results with NFYB8 antibodies:

• Sample preparation optimization:

  • Test different lysis buffers (RIPA, NP-40, Triton X-100) to determine optimal protein extraction conditions

  • Include appropriate protease inhibitors to prevent degradation

  • Consider adding reducing agents (DTT or β-mercaptoethanol) at varying concentrations to optimize epitope exposure

• Gel electrophoresis parameters:

  • Select appropriate acrylamide percentage (typically 10-12% for NFYB8's ~21 kDa size)

  • Consider gradient gels for better resolution of NFYB8 from similarly sized proteins

• Transfer optimization:

  • Test different transfer conditions (wet vs. semi-dry)

  • Optimize transfer time and voltage based on protein size

  • Consider different membrane types (PVDF vs. nitrocellulose)

• Blocking conditions:

  • Compare different blocking agents (BSA, non-fat milk, commercial blockers)

  • Test varying blocking durations (1 hour to overnight)

• Antibody incubation parameters:

  • Titrate primary antibody concentrations

  • Optimize incubation time and temperature

  • Test different wash buffer compositions and washing protocols

• Detection system selection:

  • Compare chemiluminescence, fluorescence, and colorimetric detection methods

  • Consider signal enhancement systems for low abundance targets

A systematic optimization approach using a factorial design can help identify optimal conditions efficiently, similar to approaches used in developing analytical methods for therapeutic antibodies .

How do you troubleshoot non-specific binding when using NFYB8 antibodies in immunoprecipitation?

When encountering non-specific binding in NFYB8 immunoprecipitation experiments:

• Pre-clearing the lysate:

  • Incubate lysates with protein A/G beads or control IgG before adding the NFYB8 antibody

  • Remove naturally sticky proteins by pre-incubation with an irrelevant antibody

• Antibody binding conditions:

  • Optimize antibody concentration (titrate to find minimal effective concentration)

  • Test different incubation temperatures (4°C, room temperature)

  • Adjust incubation time to minimize non-specific interactions

• Buffer optimization:

  • Increase salt concentration (from 150 mM to 300-500 mM NaCl) to reduce ionic interactions

  • Add mild detergents (0.1-0.5% Triton X-100 or NP-40) to reduce hydrophobic interactions

  • Include protein competitors (BSA, gelatin) at low concentrations

  • Test different buffer pH values

• Wash stringency:

  • Implement additional washing steps

  • Use buffers with increasing stringency for sequential washes

  • Consider adding mild denaturants in later wash steps

• Bead selection and handling:

  • Compare different types of beads (agarose, magnetic, sepharose)

  • Optimize bead amount and blocking procedures

  • Use gentle mixing methods to reduce non-specific trapping

These approaches can significantly reduce background while maintaining specific NFYB8 interactions.

What are the best practices for using NFYB8 antibodies in chromatin immunoprecipitation (ChIP) experiments?

For successful ChIP experiments with NFYB8 antibodies:

• Crosslinking optimization:

  • Test different formaldehyde concentrations (typically 0.5-1% for transcription factors)

  • Optimize crosslinking time (8-15 minutes) to balance efficiency and reversibility

  • Consider dual crosslinking with protein-protein crosslinkers for more stable complexes

• Chromatin fragmentation:

  • Optimize sonication parameters for consistent fragment sizes (200-500 bp)

  • Verify fragmentation efficiency by agarose gel electrophoresis

  • Consider enzymatic fragmentation alternatives for sensitive samples

• Antibody selection and validation:

  • Test multiple NFYB8 antibodies targeting different epitopes

  • Verify antibody specificity in Western blot before ChIP

  • Include IgG controls and input samples for normalization

• ChIP protocol considerations:

  • Use low-binding tubes to prevent sample loss

  • Implement blocking steps to reduce non-specific binding

  • Consider carrier proteins or carriers like glycogen for low-abundance targets

• Data analysis approach:

  • Design primers for known or predicted NFYB8 binding sites

  • Include negative control regions (gene deserts) for background assessment

  • Use appropriate normalization methods (percent input, IgG comparison)

  • Consider sequencing-based approaches (ChIP-seq) for genome-wide binding profiles

This methodological approach draws from practices similar to those used for other transcription factors like NF-κB, adapting them to the specific challenges of plant samples and NFYB8 biology .

How should researchers approach experimental design when studying NFYB8 across different plant developmental stages?

When investigating NFYB8 across developmental stages:

• Sampling strategy:

  • Establish clear developmental stage definitions based on standardized growth parameters

  • Include multiple biological replicates (minimum n=3) per developmental stage

  • Consider time-course experiments with appropriate temporal resolution

  • Include tissue-specific analysis where relevant (roots, leaves, flowers, etc.)

• Expression profiling integration:

  • Correlate antibody-based detection with transcriptomic data

  • Consider parallel qRT-PCR analysis of NFYB8 mRNA levels

  • Analyze co-expression patterns with known interacting partners

• Quantification approach:

  • Implement multiple detection methods (Western blot, immunofluorescence)

  • Use digital image analysis with appropriate controls for normalization

  • Consider semi-quantitative methods for tissue localization studies

• Statistical analysis:

  • Apply appropriate statistical tests based on data distribution

  • Consider multiple testing corrections for large-scale experiments

  • Report effect sizes alongside statistical significance

• Validation experiments:

  • Confirm key findings using alternate detection methods

  • Consider genetic approaches (knockdown/knockout) to validate antibody specificity

  • Use recombinant NFYB8 proteins as standards for absolute quantification

This systematic approach ensures reliable detection and interpretation of NFYB8 dynamics across developmental transitions.

What considerations should be made when interpreting conflicting NFYB8 antibody results?

When facing conflicting results with NFYB8 antibodies:

• Antibody characteristics assessment:

  • Compare epitopes targeted by different antibodies (N-terminus vs. C-terminus vs. mid-region)

  • Evaluate potential post-translational modifications that might affect epitope accessibility

  • Consider antibody format differences (monoclonal combinations vs. individual clones)

• Sample preparation variables:

  • Analyze extraction methods (native vs. denaturing conditions)

  • Consider protein-protein interactions that might mask epitopes

  • Evaluate buffer compatibility with specific antibodies

• Technical validation:

  • Implement reciprocal validation using alternative detection methods

  • Confirm protein identity by mass spectrometry where possible

  • Consider epitope competition assays to confirm specificity

• Biological context interpretation:

  • Evaluate potential biological explanations for discrepancies (splice variants, processed forms)

  • Consider tissue-specific or condition-specific protein modifications

  • Examine related family members that might cross-react

• Resolution approaches:

  • Use multiple antibodies targeting different epitopes simultaneously

  • Implement genetic approaches (tagged NFYB8 expression) for validation

  • Consider advanced techniques like proximity ligation assays for in situ confirmation

Understanding the basis of conflicting results can often reveal important biological insights about NFYB8 regulation and function.

How can researchers quantitatively compare NFYB8 levels across different experimental conditions?

For rigorous quantitative comparison of NFYB8 levels:

The documented high ELISA titer of available NFYB8 antibodies (approximately 10,000) suggests they should be suitable for quantitative applications when properly validated .

How can NFYB8 antibodies be adapted for super-resolution imaging techniques?

To adapt NFYB8 antibodies for super-resolution microscopy:

• Antibody labeling strategies:

  • Direct conjugation with small fluorophores (Alexa Fluor, Atto dyes)

  • Use of small tag detection systems (click chemistry approaches)

  • Secondary antibody fragment (Fab) utilization to reduce linkage error

• Sample preparation considerations:

  • Optimize fixation protocols to preserve antigenicity while enhancing structural preservation

  • Implement expansion microscopy protocols for plant tissues

  • Consider clearing techniques for thick samples

• Validation approaches:

  • Confirm specificity using knockout controls in the super-resolution context

  • Perform correlative imaging with conventional microscopy

  • Validate with alternative super-resolution techniques

• Technical parameters:

  • Select appropriate buffer systems compatible with both the antibody and super-resolution technique

  • Optimize labeling density for techniques like STORM and PALM

  • Implement drift correction and multi-color alignment strategies

• Quantitative analysis:

  • Develop specialized image analysis workflows for NFYB8 clustering or co-localization

  • Apply appropriate statistical tests for spatial distribution analysis

  • Consider machine learning approaches for complex pattern recognition

While no specific super-resolution applications with NFYB8 antibodies have been documented, the principles from studies of other nuclear transcription factors can be adapted.

What are the most effective strategies for multiplexing NFYB8 detection with other plant transcription factors?

For effective multiplexing of NFYB8 with other transcription factors:

• Antibody compatibility assessment:

  • Select antibodies raised in different host species to enable direct discrimination

  • Test cross-reactivity between secondary antibodies

  • Validate each antibody individually before multiplexing

• Sequential detection protocols:

  • Implement tyramide signal amplification with sequential detection and quenching

  • Use microwave-based antibody elution between detection rounds

  • Consider spectral unmixing for overlapping fluorophores

• Specialized multiplexing techniques:

  • Explore mass cytometry (CyTOF) adaptation for plant samples

  • Consider multiplexed immunohistochemistry with multispectral imaging

  • Evaluate DNA-barcoded antibody approaches

• Controls for multiplexed detection:

  • Include single-stained controls for each target

  • Implement fluorescence minus one (FMO) controls

  • Use computational approaches to identify and correct spectral overlap

• Data analysis approaches:

  • Apply colocalization algorithms (Manders, Pearson) for quantitative assessment

  • Consider machine learning for complex pattern recognition

  • Implement spatial statistics for analyzing transcription factor clustering

Effective multiplexing requires systematic optimization but enables powerful insights into transcription factor networks and co-regulation patterns.

How can researchers develop and validate custom NFYB8 antibodies for specialized applications?

For developing custom NFYB8 antibodies:

• Epitope selection strategy:

  • Analyze sequence conservation across species of interest

  • Predict surface accessibility and antigenicity

  • Avoid regions with potential post-translational modifications

  • Consider regions distinct from related NF-Y family members

• Immunization approach:

  • Compare different host species (rabbit, mouse, goat) for optimal response

  • Consider different immunization protocols (standard vs. rapid)

  • Evaluate carrier protein options and conjugation strategies

• Screening methodology:

  • Implement multi-tiered screening (ELISA, Western blot, application-specific)

  • Include native and denatured NFYB8 in screening

  • Test against the immunizing peptide and full-length protein

• Purification and characterization:

  • Affinity purify antibodies against the immunizing peptide

  • Characterize binding affinity and specificity

  • Determine optimal working concentrations for different applications

• Validation requirements:

  • Test against knockout/knockdown samples

  • Evaluate cross-reactivity with related proteins

  • Confirm target recognition in the specific application context

The documented approach of using combinations of monoclonal antibodies against different NFYB8 regions provides a model for effective custom antibody development strategies .

What are common issues in NFYB8 Western blot analysis and their solutions?

How should researchers approach batch-to-batch variability in NFYB8 antibody performance?

When addressing batch-to-batch variability:

• Standardized validation protocols:

  • Implement consistent validation methods for each new batch

  • Maintain reference samples for direct comparison

  • Document quantitative performance metrics (sensitivity, specificity)

• Internal standards implementation:

  • Create and maintain internal reference standards

  • Consider synthetic peptide standards for epitope verification

  • Establish acceptance criteria for new batches

• Lot reservation strategy:

  • Reserve sufficient antibody from successful lots for critical experiments

  • Consider bulk purchasing and proper aliquoting for long-term studies

  • Document lot numbers used for each experiment

• Adjustment protocols:

  • Develop standardized titration procedures for new lots

  • Establish optimization workflows for key applications

  • Document required protocol adjustments between batches

• Alternative approaches:

  • Maintain multiple antibody options targeting different epitopes

  • Consider recombinant antibody alternatives for greater consistency

  • Explore antibody engineering approaches for critical applications

The combination-based approach used for available NFYB8 antibodies (multiple monoclonal antibodies in each product) may provide greater consistency than single monoclonal antibodies .