NUAK2 (NUAK Family Kinase 2) is a serine/threonine kinase with a calculated molecular weight of approximately 70 kDa . Also known by alternative names including SNARK, OMPHK2, and SNF1/AMP kinase-related kinase, NUAK2 is encoded by the NUAK2 gene located on chromosome 1 in humans . The protein belongs to the AMPK (AMP-activated protein kinase) family and is particularly notable for its role in cellular stress responses . The NUAK2 protein contains specific domains that enable its kinase activity, including ATP binding sites and regulatory regions that control its activation and interaction with downstream targets .
NUAK2 serves crucial biological functions across multiple cellular processes. As a stress-activated kinase, it plays a significant role in tolerance to glucose starvation, making it an important factor in cellular energy homeostasis . Research has demonstrated that NUAK2:
Induces cell-cell detachment by increasing F-actin conversion to G-actin, affecting cellular adhesion and motility
Protects cells from CD95-mediated apoptosis, contributing to cell survival under stress conditions
Is required for increased motility and invasiveness of CD95-activated tumor cells
Phosphorylates LATS1 and LATS2, key components of the Hippo signaling pathway
Plays a crucial role in neural tube closure during embryonic development through LATS2 phosphorylation and regulation of YAP1 nuclear localization
Is activated by muscle contraction and serves as a mediator of contraction-stimulated glucose transport in skeletal muscle
Additionally, NUAK2 activity can be modulated by various factors including AMP and 5-amino-4-imidazolecarboxamide riboside, suggesting that the AMPK kinase-dependent pathway can activate NUAK2 . Expression of NUAK2 is induced by CD95 or TNF-alpha, via the NF-kappa-B pathway, linking it to inflammatory responses .
NUAK2 antibodies are generated using various immunogens, which affects their epitope specificity and applications. The immunogens typically consist of recombinant protein fragments or synthetic peptides corresponding to specific regions of the human NUAK2 protein .
Examples of immunogens used include:
Recombinant fragment within human NUAK2 amino acids 450 to C-terminus
Synthetic peptide sequence: FGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT
Recombinant fusion protein (Ag35302) for Proteintech antibody
The diversity of immunogens ensures that researchers can select antibodies recognizing different epitopes of the NUAK2 protein, allowing for verification of results through multiple antibodies targeting different regions.
NUAK2 antibodies have been validated for numerous experimental applications with varying recommended dilutions depending on the specific antibody and technique .
| Application | Validated Antibodies | Recommended Dilutions |
|---|---|---|
| Western Blot (WB) | ab126048, ab224079, 31718-1-AP, NBP1-81880, SAB1401867 | 1:500-1:3000, 1-5 μg/mL |
| Immunohistochemistry (IHC-P) | ab126048, ab224079, NBP1-81880 | 1:50 |
| Immunocytochemistry/Immunofluorescence (ICC/IF) | ab224079, NBP1-81880, SAB1401867 | 2 μg/mL for ab224079 |
| ELISA | 31718-1-AP, SAB1401867 | Varies by application |
NUAK2 antibodies have successfully detected the protein in various cell types and tissues, providing insights into its distribution and potential functional roles :
Cell lines: A549, HEK-293T, HeLa, U-251 MG (human brain glioma cell line)
Tissues: Human cervix (nucleus of squamous epithelial cells), duodenum (glandular cells), testis (nucleus of cells in seminiferous ducts), cerebellum (neuronal processes)
Immunofluorescent analysis with the ab224079 antibody has shown NUAK2 localization in the nucleoplasm, nucleoli fibrillar center, and cytosol of U-251 MG cells, suggesting diverse subcellular distributions that may relate to different functional aspects of the protein .
NUAK2 antibodies have undergone rigorous validation through multiple methods to ensure specificity and reliability:
Knockout/knockdown validation: Some antibodies like NBP1-81880 have been validated using genetic approaches to confirm specificity
Cross-reactivity testing: Tested across multiple species including human, mouse, and in some cases, rat samples
Biological validation: Functional testing in relevant biological systems
Citation in peer-reviewed publications: Several antibodies have been cited in scientific literature, providing additional validation of their utility and specificity
NUAK2 participates in several physiological processes that are essential for normal development and cellular function. Research using NUAK2 antibodies has helped elucidate these roles:
Embryonic development: NUAK2 plays a key role in neural tube closure during embryogenesis through regulation of the Hippo signaling pathway
Energy metabolism: Functions in cellular responses to glucose starvation and contraction-stimulated glucose transport in skeletal muscle
Cytoskeletal regulation: Influences cell adhesion and motility through effects on actin dynamics
Cell survival: Protects against apoptosis under certain stress conditions
NUAK2 has been implicated in several pathological conditions, making it an important target for medical research:
Anencephaly: NUAK2 is associated with Anencephaly 2 and Isolated Anencephaly, severe neural tube defects
Metabolic disorders: Involved in cellular stress responses linked to obesity and type 2 diabetes
Cancer: Required for increased motility and invasiveness of CD95-activated tumor cells, suggesting a potential role in cancer progression and metastasis
Research using NUAK2 antibodies has contributed to understanding these disease associations, potentially opening avenues for therapeutic interventions targeting NUAK2 or its signaling pathways.
NUAK2 interacts with multiple proteins and participates in several signaling pathways:
Hippo signaling pathway: Phosphorylates LATS1 and LATS2, regulating YAP1 nuclear localization, a critical downstream regulator in this pathway
AMPK pathway: Activation by AMP and related compounds suggests crosstalk with AMPK signaling
NF-kappa-B signaling: NUAK2 expression is induced via this pathway in response to CD95 or TNF-alpha stimulation
Cytoskeletal signaling: Influences actin dynamics, affecting cell structure and movement
Glucose/energy metabolism: Participates in pathways regulating cellular energy homeostasis
As research on NUAK2 continues to expand, antibodies targeting this protein will likely find new applications in both basic and translational research:
Single-cell analysis: Investigating NUAK2 expression and localization at the single-cell level to understand cellular heterogeneity
Therapeutic development: Using NUAK2 antibodies to screen for potential inhibitors or modulators of NUAK2 activity
Biomarker studies: Exploring NUAK2 as a potential biomarker for metabolic disorders or neural tube defects
Ongoing improvements in antibody technology may enhance the utility of NUAK2 antibodies:
Development of higher specificity monoclonal antibodies for improved detection sensitivity
Creation of antibodies specific to post-translationally modified forms of NUAK2
Generation of function-blocking antibodies to study NUAK2's role in live cells
NUAK2 (NUAK Family SNF1-Like Kinase 2), also known as SNARK, is a serine/threonine kinase belonging to the AMPK-related kinase family with a molecular weight of approximately 70 kDa . It has emerged as a critical player in cancer biology for several reasons:
In pancreatic cancer, NUAK2 silencing significantly impedes proliferation, migration, and invasion while triggering apoptosis in cancer cells
NUAK2 is transcriptionally regulated by NF-κB, placing it within a key inflammatory signaling pathway implicated in cancer development
It mediates oncogenic effects in pancreatic cancer by targeting SMAD2/3
NUAK2 silencing enhances sensitivity to gemcitabine in pancreatic cancer cells, suggesting therapeutic potential
It functions as a regulator of ferroptosis through suppression of glutathione metabolism
Functionally, NUAK2 is activated by various cellular stresses and shows involvement in cell adhesion, cytoskeletal regulation, and metabolic adaptation, making it a multifaceted target for investigation across cancer types.
NUAK2 antibodies have been validated for multiple research applications with specific optimization parameters:
Research demonstrates that antibody performance varies across tissue types and cell lines, with reliable detection reported in human cell lines including PANC-1, AsPC-1, BxPC-3, and U-251 MG .
NUAK2 shows distinct localization patterns that vary by cell type and condition:
Nucleoplasm and nucleoli fibrillar center localization in the U-251 MG glioma cell line
Dual nuclear and cytoplasmic positivity in human testis tissue, particularly within cells in seminiferous ducts
Dynamic redistribution in response to stress conditions or signaling activation
The dual localization pattern reflects NUAK2's diverse functions in both cytoplasmic signaling and potential nuclear regulatory roles. When designing immunostaining experiments, researchers should consider this mixed distribution pattern when interpreting results and selecting appropriate controls.
Optimizing NUAK2 detection in pancreatic cancer samples requires careful consideration of several parameters:
Tissue preparation and antigen retrieval:
Antibody validation strategies:
Signal optimization:
Perform antibody titration (1:50-1:200 for IHC-P) to determine optimal signal-to-noise ratio
Use tyramide signal amplification for weak signals
Counterstain with hematoxylin for clear visualization of tissue architecture
Multi-marker analysis:
Co-stain with markers of pancreatic cancer progression (e.g., Ki-67)
Consider dual staining with NF-κB pathway components to study regulatory relationships
Research has shown that NUAK2 is highly expressed in PDAC tissues compared to adjacent non-cancerous tissues, making it a valuable marker for investigating pancreatic cancer progression and potential therapeutic targeting .
Robust assessment of NUAK2 kinase activity requires comprehensive controls:
Genetic controls:
Activity modulation controls:
Substrate validation:
Known NUAK2 substrates (e.g., MYPT1) should be monitored for phosphorylation
Include non-substrate proteins as negative controls
Use synthetic peptide substrates with sequence specificity for quantitative kinase assays
Assay-specific controls:
ATP dependence: Perform parallel reactions with and without ATP
Cofactor requirements: Include proper Mg²⁺ concentrations
Time course studies to establish linear reaction kinetics
Importantly, research has demonstrated that NUAK2's effects on certain pathways (like GPX4 suppression) can be kinase-independent , highlighting the importance of distinguishing between kinase-dependent and independent functions through careful experimental design.
The relationship between NUAK2 and NF-κB involves complex regulatory interactions:
Transcriptional regulation:
NF-κB directly regulates NUAK2 transcription by binding to the NUAK2 promoter region
ChIP-qPCR experiments have confirmed significant enrichment of p65 binding elements in the NUAK2 promoter compared to control antibody immunoprecipitation
Luciferase reporter assays with wild-type and mutant NUAK2 promoters can validate specific binding sites
Functional relationship:
Experimental approaches to study this interaction:
Pharmacological inhibition of NF-κB with assessment of NUAK2 expression
NUAK2 overexpression in NF-κB-inhibited conditions to test rescue effects
Analysis of NF-κB target gene expression after NUAK2 modulation
Pathway integration:
This signaling axis represents a potential therapeutic vulnerability, as disrupting the NF-κB/NUAK2 relationship could interfere with pancreatic cancer progression and potentially enhance chemosensitivity .
NUAK2 functions as an enhancer of ferroptosis through specific molecular mechanisms:
GPX4 regulation:
Clinical relevance:
NUAK2 expression correlates with sensitivity to GPX4 inhibitors across various cancer cell lines
Analysis of 100 human cancer cell lines showed those most sensitive to GPX4 inhibitors had significantly higher NUAK2 expression compared to resistant lines (p<0.00001)
NUAK2 is amplified in a subset of breast cancers, particularly in the claudin-low subtype
Pathway specificity:
Experimental approaches:
Measure cell viability in NUAK2 knockdown cells treated with ferroptosis inducers (ML162, RSL3)
Monitor lipid peroxidation and glutathione metabolism
Analyze GPX4 mRNA and protein levels after NUAK2 manipulation
These findings position NUAK2 as a potential biomarker for predicting responsiveness to therapies targeting GPX4 or inducing ferroptosis, particularly relevant for cancers with NUAK2 amplification .
Differentiating between these highly homologous kinases (>60% sequence identity) requires strategic approaches:
Antibody-based discrimination:
Select antibodies targeting non-conserved regions, particularly in C-terminal domains
Validate antibody specificity using overexpression systems for each kinase
Perform western blots on NUAK1 and NUAK2 knockout samples to confirm specificity
Functional distinction methods:
RNA-based approaches:
Design qRT-PCR primers targeting unique sequence regions
Use specific siRNA/shRNA sequences that avoid cross-targeting
Employ RNA-seq for comprehensive isoform discrimination
Experimental validation table:
| Method | Specificity Consideration | Validation Approach |
|---|---|---|
| Western blot | Confirm band matches expected MW (both ~70kDa) | Use isoform-specific knockdowns |
| qRT-PCR | Primer design in divergent regions | Test on overexpression plasmids |
| Functional assays | Target pathways with differential involvement | Compare ferroptosis and TGF-β effects |
| Immunostaining | Validate with knockdown controls | Look for differential localization patterns |
Researchers should be aware that these kinases may have both overlapping and distinct functions, necessitating careful discrimination in experimental contexts .
Several technical challenges can arise when detecting NUAK2 in tissue samples:
Fixation and epitope masking issues:
Expression level variations:
Specificity concerns:
Subcellular localization complexity:
Tissue-specific optimization requirements:
To address these challenges, researchers should include appropriate positive controls (tissues known to express NUAK2) and consider dual-staining approaches to confirm identity and localization patterns.
Investigating NUAK2's role in chemoresistance requires multifaceted experimental approaches:
In vitro sensitivity models:
Recent research has demonstrated that NUAK2 silencing enhances the sensitivity of pancreatic cancer cells to gemcitabine
CCK-8 assays showed heightened sensitivity to gemcitabine when NUAK2 was knocked down
Flow cytometry revealed that gemcitabine induced significantly more apoptosis in NUAK2-knockdown cells compared to control cells
Mechanistic investigation approaches:
Analysis of cell death pathways: Measure apoptosis markers (Annexin V, cleaved caspase-3) in NUAK2-modulated cells following chemotherapy
Drug transport assessment: Evaluate expression of drug efflux pumps after NUAK2 manipulation
DNA damage response: Quantify γH2AX foci formation and DNA repair kinetics
Combination therapy studies:
Determine synergistic potential between NUAK2 inhibition and conventional chemotherapeutics
Calculate combination index values to quantify interaction effects
Test sequence-dependent effects of combination treatments
In vivo validation strategies:
Translational research opportunities:
Correlate NUAK2 expression in patient samples with treatment outcomes
Develop biomarker strategies for predicting chemotherapy response based on NUAK2 status
Explore NUAK2 inhibition as a chemosensitizing approach
The evidence that NUAK2 silencing increases sensitivity to gemcitabine suggests it could be a promising target for overcoming chemoresistance in pancreatic cancer, warranting further investigation into combination therapeutic strategies .
Comprehensive analysis of NUAK2 signaling requires monitoring of multiple downstream effectors:
SMAD pathway components:
EMT markers:
Cell proliferation and apoptosis indicators:
Ferroptosis-related targets:
Additional signaling nodes:
Methodology should include protein phosphorylation analysis by western blotting, subcellular localization by fractionation or immunofluorescence, and transcriptional regulation by qRT-PCR to fully capture the complexity of NUAK2 signaling networks.