NUAK2 Antibody

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Identification

NUAK2 (NUAK Family Kinase 2) is a serine/threonine kinase with a calculated molecular weight of approximately 70 kDa . Also known by alternative names including SNARK, OMPHK2, and SNF1/AMP kinase-related kinase, NUAK2 is encoded by the NUAK2 gene located on chromosome 1 in humans . The protein belongs to the AMPK (AMP-activated protein kinase) family and is particularly notable for its role in cellular stress responses . The NUAK2 protein contains specific domains that enable its kinase activity, including ATP binding sites and regulatory regions that control its activation and interaction with downstream targets .

Biological Functions

NUAK2 serves crucial biological functions across multiple cellular processes. As a stress-activated kinase, it plays a significant role in tolerance to glucose starvation, making it an important factor in cellular energy homeostasis . Research has demonstrated that NUAK2:

  • Induces cell-cell detachment by increasing F-actin conversion to G-actin, affecting cellular adhesion and motility

  • Protects cells from CD95-mediated apoptosis, contributing to cell survival under stress conditions

  • Is required for increased motility and invasiveness of CD95-activated tumor cells

  • Phosphorylates LATS1 and LATS2, key components of the Hippo signaling pathway

  • Plays a crucial role in neural tube closure during embryonic development through LATS2 phosphorylation and regulation of YAP1 nuclear localization

  • Is activated by muscle contraction and serves as a mediator of contraction-stimulated glucose transport in skeletal muscle

Additionally, NUAK2 activity can be modulated by various factors including AMP and 5-amino-4-imidazolecarboxamide riboside, suggesting that the AMPK kinase-dependent pathway can activate NUAK2 . Expression of NUAK2 is induced by CD95 or TNF-alpha, via the NF-kappa-B pathway, linking it to inflammatory responses .

Immunogen Information

NUAK2 antibodies are generated using various immunogens, which affects their epitope specificity and applications. The immunogens typically consist of recombinant protein fragments or synthetic peptides corresponding to specific regions of the human NUAK2 protein .

Examples of immunogens used include:

  • Recombinant fragment within human NUAK2 amino acids 1-250

  • Recombinant fragment within human NUAK2 amino acids 450 to C-terminus

  • Synthetic peptide sequence: FGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT

  • Recombinant fusion protein (Ag35302) for Proteintech antibody

The diversity of immunogens ensures that researchers can select antibodies recognizing different epitopes of the NUAK2 protein, allowing for verification of results through multiple antibodies targeting different regions.

Validated Experimental Techniques

NUAK2 antibodies have been validated for numerous experimental applications with varying recommended dilutions depending on the specific antibody and technique .

ApplicationValidated AntibodiesRecommended Dilutions
Western Blot (WB)ab126048, ab224079, 31718-1-AP, NBP1-81880, SAB14018671:500-1:3000, 1-5 μg/mL
Immunohistochemistry (IHC-P)ab126048, ab224079, NBP1-818801:50
Immunocytochemistry/Immunofluorescence (ICC/IF)ab224079, NBP1-81880, SAB14018672 μg/mL for ab224079
ELISA31718-1-AP, SAB1401867Varies by application

Cell and Tissue Expression Detection

NUAK2 antibodies have successfully detected the protein in various cell types and tissues, providing insights into its distribution and potential functional roles :

  • Cell lines: A549, HEK-293T, HeLa, U-251 MG (human brain glioma cell line)

  • Tissues: Human cervix (nucleus of squamous epithelial cells), duodenum (glandular cells), testis (nucleus of cells in seminiferous ducts), cerebellum (neuronal processes)

Immunofluorescent analysis with the ab224079 antibody has shown NUAK2 localization in the nucleoplasm, nucleoli fibrillar center, and cytosol of U-251 MG cells, suggesting diverse subcellular distributions that may relate to different functional aspects of the protein .

Validation Methods

NUAK2 antibodies have undergone rigorous validation through multiple methods to ensure specificity and reliability:

  • Knockout/knockdown validation: Some antibodies like NBP1-81880 have been validated using genetic approaches to confirm specificity

  • Cross-reactivity testing: Tested across multiple species including human, mouse, and in some cases, rat samples

  • Biological validation: Functional testing in relevant biological systems

  • Citation in peer-reviewed publications: Several antibodies have been cited in scientific literature, providing additional validation of their utility and specificity

Physiological Roles

NUAK2 participates in several physiological processes that are essential for normal development and cellular function. Research using NUAK2 antibodies has helped elucidate these roles:

  • Embryonic development: NUAK2 plays a key role in neural tube closure during embryogenesis through regulation of the Hippo signaling pathway

  • Energy metabolism: Functions in cellular responses to glucose starvation and contraction-stimulated glucose transport in skeletal muscle

  • Cytoskeletal regulation: Influences cell adhesion and motility through effects on actin dynamics

  • Cell survival: Protects against apoptosis under certain stress conditions

Disease Associations

NUAK2 has been implicated in several pathological conditions, making it an important target for medical research:

  • Anencephaly: NUAK2 is associated with Anencephaly 2 and Isolated Anencephaly, severe neural tube defects

  • Metabolic disorders: Involved in cellular stress responses linked to obesity and type 2 diabetes

  • Cancer: Required for increased motility and invasiveness of CD95-activated tumor cells, suggesting a potential role in cancer progression and metastasis

Research using NUAK2 antibodies has contributed to understanding these disease associations, potentially opening avenues for therapeutic interventions targeting NUAK2 or its signaling pathways.

Molecular Interactions and Pathways

NUAK2 interacts with multiple proteins and participates in several signaling pathways:

  • Hippo signaling pathway: Phosphorylates LATS1 and LATS2, regulating YAP1 nuclear localization, a critical downstream regulator in this pathway

  • AMPK pathway: Activation by AMP and related compounds suggests crosstalk with AMPK signaling

  • NF-kappa-B signaling: NUAK2 expression is induced via this pathway in response to CD95 or TNF-alpha stimulation

  • Cytoskeletal signaling: Influences actin dynamics, affecting cell structure and movement

  • Glucose/energy metabolism: Participates in pathways regulating cellular energy homeostasis

Emerging Applications

As research on NUAK2 continues to expand, antibodies targeting this protein will likely find new applications in both basic and translational research:

  • Single-cell analysis: Investigating NUAK2 expression and localization at the single-cell level to understand cellular heterogeneity

  • Therapeutic development: Using NUAK2 antibodies to screen for potential inhibitors or modulators of NUAK2 activity

  • Biomarker studies: Exploring NUAK2 as a potential biomarker for metabolic disorders or neural tube defects

Technological Advancements

Ongoing improvements in antibody technology may enhance the utility of NUAK2 antibodies:

  • Development of higher specificity monoclonal antibodies for improved detection sensitivity

  • Creation of antibodies specific to post-translationally modified forms of NUAK2

  • Generation of function-blocking antibodies to study NUAK2's role in live cells

Product Specs

Buffer
PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid freeze-thaw cycles.
Lead Time
Typically, we can ship your order within 1-3 business days of receiving it. Delivery times may vary depending on your location and shipping method. For specific delivery time estimates, please consult your local distributor.
Synonyms
DKFZp434J037 antibody; DKFZp686F01113 antibody; FLJ90349 antibody; NUAK family SNF1 like kinase 2 antibody; NUAK family SNF1-like kinase 2 antibody; Nuak2 antibody; NUAK2_HUMAN antibody; Omphalocele kinase 2 antibody; SNARK antibody; SNF1/AMP activated protein kinase antibody; SNF1/AMP kinase related kinase antibody; SNF1/AMP kinase-related kinase antibody
Target Names
NUAK2
Uniprot No.

Target Background

Function
NUAK2 (NUAK2/SNARK) is a stress-activated kinase implicated in glucose starvation tolerance. It promotes cell-cell detachment by increasing the conversion of F-actin to G-actin. NUAK2 expression is induced by CD95 or TNF-alpha via NF-kappa-B signaling. It protects cells from CD95-mediated apoptosis and is essential for enhanced motility and invasiveness of CD95-activated tumor cells. NUAK2 is capable of phosphorylating LATS1 at Ser-464.
Gene References Into Functions
  1. Data from studies in knockout and transgenic mice, along with other findings, indicate that NUAK2/SNARK plays a role in both adipose inflammation and energy metabolism in adipocytes. Furthermore, genome-wide association studies have linked two SNPs in NUAK2/SNARK (rs4682880, rs4682676) to obesity in women. PMID: 29298809
  2. miR143 was found to inhibit the proliferation, migration, and invasion of glioblastoma cells by degrading NUAK2. PMID: 27081712
  3. The combined roles of Sucrose non-fermenting AMPK related kinase (NUAK2) and Pentraxin 3 in immunometabolic signaling and DNA damage response are proposed to accelerate cardiovascular complications in systemic lupus erythematosus patients. PMID: 25732129
  4. Silencing NUAK2 and inactivation of the PI3K pathway effectively controlled CDK2 expression. Notably, CDK2 inactivation specifically inhibited the growth of NUAK2-amplified and PTEN-deficient melanoma cells. PMID: 25832654
  5. The AMPK-related kinase SNARK regulates hepatitis C virus replication and pathogenesis through enhancement of TGF-beta signaling. PMID: 23831117
  6. Activation of AMP-activated protein kinase (AMPK) safeguards the integrity of the blood-brain barrier by suppressing the induction of NADPH oxidase-derived superoxide anions. PMID: 22796592
  7. This research highlights potential roles of NUAK2 in tumorigenesis, suggesting a pivotal role in acral melanomagenesis. PMID: 21911917
  8. MLCP (myosin light chain phosphatase) activation is counteracted by a previously unknown association between MRIP (myosin phosphatase Rho-interacting protein) and the inducible kinase NUAK2. PMID: 21242312
  9. This study reinforces the importance of NUAK2 in cancer development and tumor progression, while AMPK exhibits anti-oncogenic properties. PMID: 21460252
  10. Data show that SNARK is activated by muscle contraction and serves as a unique mediator of contraction-stimulated glucose transport in skeletal muscle. PMID: 20713714
  11. SNARK is an NF-kappaB-regulated anti-apoptotic gene that contributes to the tumor-promoting activity of CD95 in apoptosis-resistant tumor cells. PMID: 15345718
  12. These data suggest distinct phosphorylation and regulation of MYPT1 activity by NUAK2. PMID: 18023418
  13. EBV LMP1 upregulated the expression of SNARK. Increased SNARK expression led to drug resistance in response to doxorubicin, enhancing cancer cell survival. PMID: 18452098
  14. The nuclear-localizing SNARK altered transcriptome profiles, with a significant portion of these alterations reversed by the mutation of NLS, suggesting the ability of SNARK to modulate gene expression depending on its nuclear localization. PMID: 18992219
  15. Skeletal muscle SNARK expression is elevated in human obesity and in response to metabolic stressors, but not in type 2 diabetes. Partial SNARK depletion did not affect glucose or lipid metabolism. PMID: 19652946
  16. This study describes the cloning and characterization of the rat SNARK homolog, mapping of the human SNARK gene to 1q32, and a potential functional role as a mediator of the cellular response to metabolic stress. PMID: 11284715

Show More

Hide All

Database Links

HGNC: 29558

OMIM: 608131

KEGG: hsa:81788

STRING: 9606.ENSP00000356125

UniGene: Hs.497512

Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily

Q&A

What is NUAK2 and why is it significant in cancer research?

NUAK2 (NUAK Family SNF1-Like Kinase 2), also known as SNARK, is a serine/threonine kinase belonging to the AMPK-related kinase family with a molecular weight of approximately 70 kDa . It has emerged as a critical player in cancer biology for several reasons:

  • In pancreatic cancer, NUAK2 silencing significantly impedes proliferation, migration, and invasion while triggering apoptosis in cancer cells

  • NUAK2 is transcriptionally regulated by NF-κB, placing it within a key inflammatory signaling pathway implicated in cancer development

  • It mediates oncogenic effects in pancreatic cancer by targeting SMAD2/3

  • NUAK2 silencing enhances sensitivity to gemcitabine in pancreatic cancer cells, suggesting therapeutic potential

  • It functions as a regulator of ferroptosis through suppression of glutathione metabolism

Functionally, NUAK2 is activated by various cellular stresses and shows involvement in cell adhesion, cytoskeletal regulation, and metabolic adaptation, making it a multifaceted target for investigation across cancer types.

What are the validated applications for NUAK2 antibodies?

NUAK2 antibodies have been validated for multiple research applications with specific optimization parameters:

ApplicationValidated ConditionsNotes
Western Blot0.04-0.4 μg/ml or 1:500-1:3000 dilutionDetects endogenous NUAK2 at ~70 kDa
Immunohistochemistry (Paraffin)1:50-1:200 dilutionHIER pH 6 retrieval recommended
Immunocytochemistry/Immunofluorescence0.25-2 μg/ml or 1:50-1:200 dilutionPFA/Triton X-100 fixation/permeabilization
Knockout/Knockdown ValidationValidated in siRNA/shRNA systemsEssential control for specificity

Research demonstrates that antibody performance varies across tissue types and cell lines, with reliable detection reported in human cell lines including PANC-1, AsPC-1, BxPC-3, and U-251 MG .

What subcellular localization patterns does NUAK2 exhibit?

NUAK2 shows distinct localization patterns that vary by cell type and condition:

  • Nucleoplasm and nucleoli fibrillar center localization in the U-251 MG glioma cell line

  • Cytoplasmic distribution in multiple cancer cell lines

  • Dual nuclear and cytoplasmic positivity in human testis tissue, particularly within cells in seminiferous ducts

  • Dynamic redistribution in response to stress conditions or signaling activation

The dual localization pattern reflects NUAK2's diverse functions in both cytoplasmic signaling and potential nuclear regulatory roles. When designing immunostaining experiments, researchers should consider this mixed distribution pattern when interpreting results and selecting appropriate controls.

How should I optimize NUAK2 antibody usage in pancreatic cancer tissues?

Optimizing NUAK2 detection in pancreatic cancer samples requires careful consideration of several parameters:

  • Tissue preparation and antigen retrieval:

    • For FFPE samples, use heat-induced epitope retrieval (HIER) in citrate buffer (pH 6.0)

    • Optimize retrieval time (typically 15-20 minutes) to balance signal recovery and tissue integrity

    • For fresh frozen sections, brief fixation in 4% PFA provides good epitope preservation

  • Antibody validation strategies:

    • Use normal pancreatic tissue as a negative/low expression control

    • PDAC tissues show significantly higher NUAK2 expression compared to adjacent non-cancerous tissues

    • Include NUAK2 knockdown/knockout samples as definitive negative controls

  • Signal optimization:

    • Perform antibody titration (1:50-1:200 for IHC-P) to determine optimal signal-to-noise ratio

    • Use tyramide signal amplification for weak signals

    • Counterstain with hematoxylin for clear visualization of tissue architecture

  • Multi-marker analysis:

    • Co-stain with markers of pancreatic cancer progression (e.g., Ki-67)

    • Consider dual staining with NF-κB pathway components to study regulatory relationships

Research has shown that NUAK2 is highly expressed in PDAC tissues compared to adjacent non-cancerous tissues, making it a valuable marker for investigating pancreatic cancer progression and potential therapeutic targeting .

What controls are essential when studying NUAK2 kinase activity?

Robust assessment of NUAK2 kinase activity requires comprehensive controls:

  • Genetic controls:

    • Kinase-dead NUAK2 mutants - research shows these mutants fail to restore anti-tumor effects of NF-κB inhibitors, confirming kinase-dependent functions

    • NUAK2 knockout/knockdown cells to establish baseline signal

    • Wild-type NUAK2 overexpression systems for gain-of-function studies

  • Activity modulation controls:

    • Positive activators: AMP and 5-amino-4-imidazolecarboxamide riboside increase NUAK2 activity

    • Stress conditions: Glucose deprivation increases NUAK2 activity in fibroblasts

    • Inhibitor controls: Use available AMPK family inhibitors with appropriate specificity caveats

  • Substrate validation:

    • Known NUAK2 substrates (e.g., MYPT1) should be monitored for phosphorylation

    • Include non-substrate proteins as negative controls

    • Use synthetic peptide substrates with sequence specificity for quantitative kinase assays

  • Assay-specific controls:

    • ATP dependence: Perform parallel reactions with and without ATP

    • Cofactor requirements: Include proper Mg²⁺ concentrations

    • Time course studies to establish linear reaction kinetics

Importantly, research has demonstrated that NUAK2's effects on certain pathways (like GPX4 suppression) can be kinase-independent , highlighting the importance of distinguishing between kinase-dependent and independent functions through careful experimental design.

How does NUAK2 interact with the NF-κB signaling pathway?

The relationship between NUAK2 and NF-κB involves complex regulatory interactions:

  • Transcriptional regulation:

    • NF-κB directly regulates NUAK2 transcription by binding to the NUAK2 promoter region

    • ChIP-qPCR experiments have confirmed significant enrichment of p65 binding elements in the NUAK2 promoter compared to control antibody immunoprecipitation

    • Luciferase reporter assays with wild-type and mutant NUAK2 promoters can validate specific binding sites

  • Functional relationship:

    • NUAK2 overexpression partially restores cell survival and migration capacity inhibited by NF-κB inhibitor BAY11-7082

    • NUAK2 overexpression reduces apoptosis induced by NF-κB inhibition

    • NUAK2 partially restores N-cadherin expression reduced by NF-κB inhibition

  • Experimental approaches to study this interaction:

    • Pharmacological inhibition of NF-κB with assessment of NUAK2 expression

    • NUAK2 overexpression in NF-κB-inhibited conditions to test rescue effects

    • Analysis of NF-κB target gene expression after NUAK2 modulation

  • Pathway integration:

    • The NF-κB/NUAK2 axis influences SMAD signaling in pancreatic cancer

    • This creates a signaling network connecting inflammation (NF-κB) with TGF-β/SMAD pathways

This signaling axis represents a potential therapeutic vulnerability, as disrupting the NF-κB/NUAK2 relationship could interfere with pancreatic cancer progression and potentially enhance chemosensitivity .

What is the relationship between NUAK2 and ferroptosis regulation?

NUAK2 functions as an enhancer of ferroptosis through specific molecular mechanisms:

  • GPX4 regulation:

    • siRNA-mediated silencing of NUAK2 suppresses cell death by small-molecule inducers of ferroptosis but not apoptosis

    • NUAK2 suppresses GPX4 expression at both protein and RNA levels

    • This suppression is independent of NUAK2's kinase activity, representing a kinase-independent function

  • Clinical relevance:

    • NUAK2 expression correlates with sensitivity to GPX4 inhibitors across various cancer cell lines

    • Analysis of 100 human cancer cell lines showed those most sensitive to GPX4 inhibitors had significantly higher NUAK2 expression compared to resistant lines (p<0.00001)

    • NUAK2 is amplified in a subset of breast cancers, particularly in the claudin-low subtype

  • Pathway specificity:

    • Unlike AMPK which modulates ferroptosis vulnerability partly through lipid metabolism, NUAK2 acts directly on GPX4

    • NUAK2-mediated GPX4 suppression was found to be independent of YAP/TAZ pathway

    • NUAK2, but not its close relative NUAK1, regulates GPX4 expression and ferroptotic sensitivity

  • Experimental approaches:

    • Measure cell viability in NUAK2 knockdown cells treated with ferroptosis inducers (ML162, RSL3)

    • Monitor lipid peroxidation and glutathione metabolism

    • Analyze GPX4 mRNA and protein levels after NUAK2 manipulation

These findings position NUAK2 as a potential biomarker for predicting responsiveness to therapies targeting GPX4 or inducing ferroptosis, particularly relevant for cancers with NUAK2 amplification .

How can I distinguish between NUAK1 and NUAK2 in my experiments?

Differentiating between these highly homologous kinases (>60% sequence identity) requires strategic approaches:

  • Antibody-based discrimination:

    • Select antibodies targeting non-conserved regions, particularly in C-terminal domains

    • Validate antibody specificity using overexpression systems for each kinase

    • Perform western blots on NUAK1 and NUAK2 knockout samples to confirm specificity

  • Functional distinction methods:

    • Exploit differential effects on TGF-β signaling (NUAK2 enhances while NUAK1 suppresses TGF-β signaling)

    • Analyze ferroptosis sensitivity (NUAK2, but not NUAK1, regulates ferroptotic sensitivity)

    • Examine specific substrate phosphorylation patterns that differ between the kinases

  • RNA-based approaches:

    • Design qRT-PCR primers targeting unique sequence regions

    • Use specific siRNA/shRNA sequences that avoid cross-targeting

    • Employ RNA-seq for comprehensive isoform discrimination

  • Experimental validation table:

MethodSpecificity ConsiderationValidation Approach
Western blotConfirm band matches expected MW (both ~70kDa)Use isoform-specific knockdowns
qRT-PCRPrimer design in divergent regionsTest on overexpression plasmids
Functional assaysTarget pathways with differential involvementCompare ferroptosis and TGF-β effects
ImmunostainingValidate with knockdown controlsLook for differential localization patterns

Researchers should be aware that these kinases may have both overlapping and distinct functions, necessitating careful discrimination in experimental contexts .

What are common challenges in detecting NUAK2 in tissue samples?

Several technical challenges can arise when detecting NUAK2 in tissue samples:

  • Fixation and epitope masking issues:

    • Over-fixation: Excessive formalin fixation can mask NUAK2 epitopes

    • Solution: Optimize antigen retrieval with HIER pH 6 buffer specifically recommended for NUAK2 antibodies

    • For difficult samples, try enzyme-based retrieval as an alternative

  • Expression level variations:

    • NUAK2 expression varies significantly between tissue types

    • PDAC tissues show high expression compared to adjacent non-cancerous tissues

    • Low expression tissues may require signal amplification systems

  • Specificity concerns:

    • Cross-reactivity with NUAK1 due to sequence homology

    • Non-specific binding in certain tissue types

    • Resolution: Always include knockout/knockdown validation

  • Subcellular localization complexity:

    • NUAK2 shows both nuclear and cytoplasmic localization

    • Different fixation methods can affect observed localization patterns

    • Dual localization may complicate interpretation in tissue sections

  • Tissue-specific optimization requirements:

    • Antibody dilutions often need adjustment based on tissue type

    • Background levels vary between tissues, requiring protocol modifications

    • Recommended dilution ranges (1:50-1:200) should be titrated for each tissue type

To address these challenges, researchers should include appropriate positive controls (tissues known to express NUAK2) and consider dual-staining approaches to confirm identity and localization patterns.

How can NUAK2 be studied in relation to chemoresistance mechanisms?

Investigating NUAK2's role in chemoresistance requires multifaceted experimental approaches:

  • In vitro sensitivity models:

    • Recent research has demonstrated that NUAK2 silencing enhances the sensitivity of pancreatic cancer cells to gemcitabine

    • CCK-8 assays showed heightened sensitivity to gemcitabine when NUAK2 was knocked down

    • Flow cytometry revealed that gemcitabine induced significantly more apoptosis in NUAK2-knockdown cells compared to control cells

  • Mechanistic investigation approaches:

    • Analysis of cell death pathways: Measure apoptosis markers (Annexin V, cleaved caspase-3) in NUAK2-modulated cells following chemotherapy

    • Drug transport assessment: Evaluate expression of drug efflux pumps after NUAK2 manipulation

    • DNA damage response: Quantify γH2AX foci formation and DNA repair kinetics

  • Combination therapy studies:

    • Determine synergistic potential between NUAK2 inhibition and conventional chemotherapeutics

    • Calculate combination index values to quantify interaction effects

    • Test sequence-dependent effects of combination treatments

  • In vivo validation strategies:

    • Xenograft models with NUAK2-knockdown cells show reduced tumor growth

    • Test chemotherapy efficacy in these models with tumor volume and survival as endpoints

    • Analyze tumor samples for molecular markers of treatment response and resistance

  • Translational research opportunities:

    • Correlate NUAK2 expression in patient samples with treatment outcomes

    • Develop biomarker strategies for predicting chemotherapy response based on NUAK2 status

    • Explore NUAK2 inhibition as a chemosensitizing approach

The evidence that NUAK2 silencing increases sensitivity to gemcitabine suggests it could be a promising target for overcoming chemoresistance in pancreatic cancer, warranting further investigation into combination therapeutic strategies .

What downstream targets should be monitored when studying NUAK2 signaling?

Comprehensive analysis of NUAK2 signaling requires monitoring of multiple downstream effectors:

  • SMAD pathway components:

    • p-SMAD2/3 and total SMAD2/3: NUAK2 knockdown remarkably reduces both phosphorylated and total levels

    • SMAD4: NUAK2 knockdown decreases nuclear translocation of SMAD4

    • In SMAD4-negative cells, NUAK2 knockdown impacts FAK signaling via SMAD2/3 downregulation

  • EMT markers:

    • N-cadherin: NUAK2 overexpression partially restores N-cadherin expression reduced by NF-κB inhibition

    • E-cadherin: Should be monitored although some studies show limited direct effect

    • Additional EMT markers like vimentin and Snail/Slug may provide comprehensive pathway assessment

  • Cell proliferation and apoptosis indicators:

    • Ki-67: IHC staining reveals significant reduction following NUAK2 knockdown in xenograft models

    • Apoptosis markers: Cleaved caspase-3, PARP cleavage

    • Cell cycle regulators: Cyclins, CDKs and their inhibitors

  • Ferroptosis-related targets:

    • GPX4: NUAK2 suppresses GPX4 expression at both protein and RNA levels

    • Glutathione metabolism components

    • Lipid peroxidation markers

  • Additional signaling nodes:

    • YAP/TAZ: While GPX4 regulation appears YAP/TAZ-independent, other NUAK2 functions involve this pathway

    • MYPT1: A shared substrate between NUAK1 and NUAK2

    • LATS kinases: Potential mediators of NUAK2 effects on growth control pathways

Methodology should include protein phosphorylation analysis by western blotting, subcellular localization by fractionation or immunofluorescence, and transcriptional regulation by qRT-PCR to fully capture the complexity of NUAK2 signaling networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.