NUDT13 Antibody

Overview of NUDT13 Antibody

NUDT13 antibodies are polyclonal reagents designed to target the Nudix Hydrolase 13 protein (UniProt ID: Q86X67), which hydrolyzes reduced pyridine nucleotides like NADH and NADPH . These antibodies are validated for applications including:

• Western Blot (WB)

• Immunohistochemistry (IHC)

• Enzyme-Linked Immunosorbent Assay (ELISA)

Key suppliers include Thermo Fisher Scientific (PA5-59234), Proteintech (25912-1-AP), and Abcepta (AI12941) .

Protein Features

• Molecular Weight: ~40 kDa (calculated), observed at 30–40 kDa due to post-translational modifications .

• Immunogen Sequence: QDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISASLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWH .

• Gene ID: 25961 (Human) .

Functional Domains

• Catalytic Nudix Box: Responsible for hydrolase activity .

• Mitochondrial Targeting Sequence: Residues 1–27 direct localization to mitochondria .

Substrate Specificity

Data derived from recombinant mouse Nudt13 assays .

Mitochondrial Localization

• NUDT13 is targeted to mitochondria via an N-terminal peptide, as shown by GFP fusion experiments in HeLa cells .

• Co-localizes with Mitotracker Red, confirming mitochondrial matrix activity .

Enzymatic Activity

• Km for NADH: 0.34 mM

• kcat: 7 s⁻¹ .

• Prefers reduced dinucleotides (NAD(P)H) over oxidized forms (NAD(P)+) .

Role in Cancer

• Expression in Tumors: Elevated in colorectal, breast, and lung cancers (Human Protein Atlas) .

• Functional Impact: siRNA knockdown of NUDT13 reduces viability in non-cancer colon epithelial cells (CCD841) but not in cancer cell lines (A549, MCF7) .

Cross-Reactivity

Recommended Dilutions

Data compiled from Thermo Fisher, Proteintech, and Abcepta protocols .

Applications in Disease Research

NUDT13 antibodies are critical for:

1. Metabolic Studies: Tracking NAD(P)H dynamics in mitochondrial energy pathways .

2. Cancer Biomarker Analysis: Correlating protein expression levels with tumor progression .

3. Redox Signaling: Investigating oxidative stress responses linked to NADPH hydrolysis .