NUPL1 Antibody

What is NUPL1 and what is its role in cellular function?

Research has shown that NUPL1 can exist in multiple transcriptional splice variants that encode different isoforms, suggesting a complex role in nuclear transport regulation that may vary across cell types and physiological conditions . The protein has also been implicated in viral infection processes, particularly HIV-1 infection pathways, indicating its potential importance in cellular antiviral responses .

What are the structural characteristics of NUPL1?

NUPL1 is characterized by a calculated molecular weight of 599 amino acids with a predicted molecular weight of 61 kDa, though it typically appears at approximately 65 kDa when observed in Western blot applications . The protein is encoded by the gene ID 9818 (NCBI) and has a UniProt ID of Q9BVL2 .

The specific amino acid sequence that has been used for antibody development includes the segment: RNTLNIDKLKIETALELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKI, which represents a functional epitope of the protein . This sequence information is particularly valuable for researchers designing experiments that require specific epitope targeting or when evaluating antibody cross-reactivity.

What applications are NUPL1 antibodies validated for?

NUPL1 antibodies have been validated for multiple experimental applications, with varying levels of optimization across different antibody products. Based on available data, these applications include:

When using NUPL1 antibodies, researchers should note that optimal dilutions may be sample-dependent, and titration in each testing system is recommended to obtain optimal results . Published research has utilized these antibodies primarily in Western blot applications, with at least two publications cited specifically for this application .

Which cell types and tissues show positive reactivity with NUPL1 antibodies?

NUPL1 antibodies have demonstrated positive reactivity in various human and rodent samples. Specifically, Western blot detection has been successful in:

• Human cell lines: HepG2 cells, HeLa cells, L02 cells

• Animal tissues: Mouse brain tissue

The antibodies have shown cross-reactivity with human, mouse, and rat samples, making them versatile tools for comparative studies across these species . When designing experiments, researchers should consider that NUPL1 expression levels and potentially isoform distribution vary significantly between different cell types, which may affect antibody binding efficiency and experimental outcomes .

What are the recommended storage and handling conditions for NUPL1 antibodies?

To maintain optimal antibody performance, NUPL1 antibodies should be stored according to manufacturer specifications. Typical storage recommendations include:

• Short-term storage: 4°C

• Long-term storage: -20°C

• Stability: Typically stable for one year after shipment when stored properly

• Aliquoting: For 19907-1-AP, aliquoting is unnecessary for -20°C storage, though this may vary by product

• Buffer composition: Most preparations are in PBS (pH 7.2) with additives such as 40-50% glycerol and 0.02% sodium azide

To avoid degradation, researchers should minimize freeze-thaw cycles and follow manufacturer recommendations for handling the specific antibody formulation they are using .

How does cellular heterogeneity in NUPL1 expression affect experimental design?

Research has demonstrated substantial heterogeneity in nucleoporin expression levels across different cell types. For instance, studies have shown marked differences in the expression of various nucleoporins, including NUPL1, between T cells, macrophages, and established cell lines . This heterogeneity can have profound implications for experimental design and interpretation of results.

When planning experiments involving NUPL1, researchers should consider:

• Cell type selection: Different cell types may express varying levels of NUPL1 or alternative isoforms that could affect antibody recognition and experimental outcomes .

• Controls: Proper positive and negative controls specific to the cell type being studied are essential for accurate interpretation of results.

• Validation across systems: Observations made in one cell type may not be generalizable to other systems due to differences in NUPL1 expression and function .

What is the role of NUPL1 in HIV-1 infection and how can researchers study this interaction?

NUPL1 has been implicated in HIV-1 infection processes. Research has shown that HIV-1 capsid protein (CA) can bind to multiple nucleoporins, including NUPL1, and that variation in nucleoporin levels impacts HIV-1 infection . This interaction is complex and appears to be influenced by multiple factors:

• Cellular context: The effects of NUPL1 depletion on HIV-1 infection vary significantly between cell types. For example, depletion studies have shown different effects in HeLa versus HT1080 or HOS cells .

• Cell cycle status: The importance of NUPL1 in HIV-1 infection differs between dividing and non-dividing cells. In HOS cells, NUPL1 depletion had larger effects in non-dividing compared to dividing cells .

• Relationship with antiviral factors: NUPL1 depletion can affect the antiviral activity of MX2, an interferon-induced protein with antiviral activity against HIV-1 .

For researchers studying these interactions, it is recommended to:

• Use multiple cell types to verify observations

• Control for cell cycle status in experiments

• Consider the complex interplay between nucleoporins, viral components, and host antiviral factors

• Employ appropriate knockdown/knockout validation methods to confirm specificity of observed effects

It's important to note that "assigning a direct role of a single Nup in HIV-1 infection or MX2 activity likely cannot be unambiguously achieved using a knockdown/knockout approach" due to the pleiotropic effects of nucleoporin depletion .

What controls should be used when working with NUPL1 antibodies?

When designing experiments with NUPL1 antibodies, appropriate controls are essential for result validation. Recommended controls include:

• Positive tissue/cell controls:

  • HepG2 cells, HeLa cells, L02 cells, and mouse brain tissue have been verified as positive for NUPL1 expression and can serve as appropriate positive controls .

• Loading and technique controls:

  • Standard housekeeping proteins (β-actin, GAPDH) should be included for Western blot applications

  • Include appropriate isotype control antibodies (Rabbit IgG for polyclonal NUPL1 antibodies) to assess non-specific binding

• Knockdown/knockout validation:

  • Given the specificity challenges with antibodies, NUPL1 knockdown or knockout samples provide the gold standard for validating antibody specificity

  • This is particularly important as some NUPL1 antibodies may recognize alternative isoforms or cross-react with related proteins

• Peptide competition:

  • When available, blocking the antibody with the immunogen peptide can help validate specificity of observed signals

The specificity of antibody 19907-1-AP has been tested against NUPL1 fusion protein, while NBP2-13684 was developed against a recombinant protein corresponding to specific amino acids of NUPL1 . Understanding the exact epitope recognized by each antibody is valuable when interpreting experimental results.

What factors might affect the observed molecular weight of NUPL1 in Western blot applications?

While the calculated molecular weight of NUPL1 is 61 kDa (599 amino acids), the observed molecular weight in Western blot applications is typically around 65 kDa . Several factors might contribute to this discrepancy and to variations in observed molecular weight across different experimental systems:

• Post-translational modifications: NUPL1 may undergo modifications such as phosphorylation, glycosylation, or other modifications that increase its apparent molecular weight.

• Alternative splicing: NUPL1 has known alternative transcriptional splice variants encoding different isoforms , which may result in proteins of different molecular weights.

• Cell type variation: Research has indicated potential differences in the expression of alternative isoforms of nucleoporins, including NUPL1, between different cell types . This could lead to different banding patterns depending on the cell type being studied.

• Experimental conditions: SDS-PAGE conditions, including gel percentage, running buffer composition, and sample preparation methods can affect protein migration and observed molecular weight.

When unexpected molecular weight patterns are observed, researchers should consider:

• Comparing results across multiple cell types

• Using different antibodies targeting distinct epitopes of NUPL1

• Employing knockdown/knockout validation to confirm band identity

• Investigating the possibility of post-translational modifications or alternative splicing in their specific experimental system

How can researchers optimize NUPL1 antibody performance for immunofluorescence applications?

For optimal immunofluorescence results with NUPL1 antibodies, researchers should consider the following methodological approaches:

• Fixation optimization:

  • Since NUPL1 is a nuclear pore component, different fixation methods may affect epitope accessibility

  • Compare paraformaldehyde versus methanol fixation, as membrane proteins sometimes show better results with methanol

• Permeabilization considerations:

  • Nuclear pore proteins may require careful optimization of permeabilization conditions

  • Test different detergents (Triton X-100, saponin) and concentrations to maximize signal while preserving structure

• Antibody dilution:

  • While specific immunofluorescence dilutions are not provided in the available data, researchers should start with the manufacturer's recommendations and perform a dilution series

  • For polyclonal antibodies like those against NUPL1, optimization of concentration is particularly important to minimize background

• Signal enhancement strategies:

  • Consider tyramide signal amplification for low-abundance epitopes

  • Use appropriate blocking reagents to minimize non-specific binding

• Validation approaches:

  • Use co-staining with established nuclear pore markers

  • Include NUPL1 knockdown/knockout samples as negative controls

  • Consider the characteristic nuclear rim staining pattern expected for NUPL1 as a validation criterion

Given that NUPL1 antibodies have been validated for immunofluorescence applications , researchers can expect successful detection of this protein with proper optimization.

How is NUPL1 being studied in viral infection mechanisms?

NUPL1's role in viral infection, particularly HIV-1 infection, represents an important area of research. Studies have revealed several key aspects of NUPL1's involvement:

• Direct interaction with viral components:

  • HIV-1 capsid protein (CA) has been shown to bind multiple nucleoporins, including NUPL1

  • These interactions appear to facilitate viral nuclear entry and potentially integration

• Cell-type dependent effects:

  • The importance of NUPL1 in HIV-1 infection varies between cell types

  • In HOS cells, NUPL1 depletion had larger effects in non-dividing compared to dividing cells, suggesting context-dependent functions

• Relationship with antiviral mechanisms:

  • NUPL1 depletion affects the antiviral activity of MX2, an interferon-induced protein with anti-HIV-1 activity

  • This suggests NUPL1 may play a role in innate immune responses to viral infection

Future research directions may include:

• Structural studies of NUPL1-viral protein interactions

• Investigation of how NUPL1 variation affects susceptibility to different viral pathogens

• Development of therapeutic approaches targeting NUPL1-virus interactions

Researchers studying these mechanisms should consider the complex interplay between nucleoporins, viral components, and host factors, and employ multiple complementary approaches to validate observations.

What considerations should be made when studying NUPL1 in different disease contexts?

When investigating NUPL1 in disease contexts, researchers should consider several important factors:

• Expression variability:

  • Nucleoporin expression, including NUPL1, varies significantly between cell types and potentially disease states

  • Baseline characterization of NUPL1 expression in relevant healthy tissues is essential for comparative studies

• Methodological approach selection:

  • For protein-level studies, antibody-based methods (Western blot, IHC, IF) have been validated

  • For broader pathway analyses, consider combining antibody approaches with genomic or proteomic analyses

• Context-specific interactions:

  • NUPL1 functions as part of the nuclear pore complex, interacting with multiple proteins

  • Disease-specific alterations may affect these interactions rather than NUPL1 expression itself

  • Consider proximity ligation assays or co-immunoprecipitation to study context-specific interaction changes

• Replication across models:

  • Given the heterogeneity in NUPL1 effects observed across cell types, findings should be validated in multiple models

  • Cell lines, primary cells, and where possible, patient samples should be compared

• Functional significance assessment:

  • Beyond expression changes, functional studies (e.g., nuclear transport assays) should be employed to determine the significance of NUPL1 alterations in disease contexts

The complex nature of nuclear pore composition and the potential for pleiotropic effects when manipulating individual components like NUPL1 necessitate careful experimental design and interpretation in disease-related research .