ogfod2 Antibody

What is OGFOD2 and why is it studied in molecular biology research?

OGFOD2 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 2) is a protein that belongs to the family of iron and 2-oxoglutarate-dependent dioxygenases. These enzymes catalyze hydroxylation reactions using molecular oxygen, with 2-oxoglutarate as a co-substrate. OGFOD2 is studied for its potential role in cellular processes including oxygen sensing and metabolic regulation. Recent research has linked OGFOD2 to neuropsychiatric disorders, as evidenced by its citation in schizophrenia-associated genetic loci studies . The protein contains specific domains that enable its enzymatic activity (EC 1.14.11.-) and is also known by several alternative names including FLJ13491, FLJ37501, and DKFZp686H15154 .

To effectively study this protein, researchers typically employ antibodies that specifically recognize OGFOD2 in various experimental contexts, allowing for detailed investigation of its expression patterns, interactions, and functional roles in cellular processes.

Proper storage and handling of OGFOD2 antibodies is crucial for maintaining their specificity and activity. Based on manufacturer recommendations:

• Unconjugated antibodies should be stored at 4°C for short-term use (typically up to 2 weeks) .

• For long-term storage, antibodies should be aliquoted and stored at -20°C .

• Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of antibody activity .

• Conjugated antibodies (e.g., DyLight 594-labeled) require storage at 4°C in the dark to prevent photobleaching of the fluorophore .

• Lyophilized antibodies should be reconstituted in the recommended buffer (often sterile water or PBS) before use .

For reconstitution of lyophilized OGFOD2 antibodies, manufacturers typically recommend using 200 μl of sterile H₂O, which yields a usable antibody solution containing additional stabilizers such as 2% BSA and 0.02% sodium azide .

What controls should be included when using OGFOD2 antibodies?

Implementing proper controls is essential for ensuring the reliability and specificity of OGFOD2 antibody experiments:

• Positive Controls: Use samples or cell lines with confirmed OGFOD2 expression. Human cell lines are commonly used when working with human-reactive OGFOD2 antibodies .

• Negative Controls: Include samples known to lack OGFOD2 expression or use siRNA knockdown controls when possible.

• Blocking Peptide Controls: Utilize specific OGFOD2 blocking peptides to confirm antibody specificity. These peptides contain the immunogen sequence used to generate the antibody and can effectively neutralize specific binding when pre-incubated with the primary antibody .

• Isotype Controls: Include an isotype-matched control antibody (typically rabbit IgG for OGFOD2 antibodies) to identify non-specific binding .

• Secondary Antibody Controls: Run a control omitting the primary antibody to assess background signal from the secondary antibody.

For validation, some manufacturers report testing OGFOD2 antibodies on protein arrays containing the target protein plus 383 non-specific proteins to ensure specificity .

What are the optimal protocols for detecting OGFOD2 in different sample types?

Detection protocols for OGFOD2 vary depending on sample type and experimental context. Below are optimized methodologies for different applications:

Western Blot Protocol for OGFOD2 Detection:

• Prepare protein lysates from tissues or cells of interest in RIPA buffer with protease inhibitors

• Separate 20-50 μg of protein by SDS-PAGE (10% gel recommended)

• Transfer to PVDF or nitrocellulose membrane

• Block with 5% non-fat milk in TBST for 1 hour at room temperature

• Incubate with OGFOD2 primary antibody at 0.4 μg/ml dilution overnight at 4°C

• Wash 3× with TBST

• Incubate with appropriate HRP-conjugated secondary antibody

• Develop using chemiluminescence reagents

• Expected molecular weight: approximately 79.6 kDa

Immunohistochemistry Protocol for OGFOD2:

• Deparaffinize and rehydrate tissue sections

• Perform antigen retrieval (citrate buffer pH 6.0 recommended)

• Block endogenous peroxidase with 3% H₂O₂

• Block non-specific binding with 5% normal serum

• Incubate with OGFOD2 antibody at 1:50 to 1:200 dilution

• Apply appropriate detection system (e.g., HRP-polymer and DAB)

• Counterstain, dehydrate, and mount

For immunofluorescence applications using conjugated antibodies like DyLight 594-labeled OGFOD2 antibodies, additional considerations include minimizing exposure to light throughout the protocol and using appropriate mounting media with anti-fade properties .

How can researchers address potential cross-reactivity with other oxygenase family proteins?

OGFOD2 belongs to a family of proteins with similar domains, which presents challenges for antibody specificity. To address potential cross-reactivity:

• Epitope Analysis: Examine the immunogen sequence used to generate the antibody. For example, some OGFOD2 antibodies are raised against a 17-amino acid synthetic peptide near the center of human OGFOD2 (within amino acids 140-190) , while others target recombinant fragments corresponding to amino acids 5-173 or include the sequence ARPEVYDSLQDAALAPEFLAVTEYSVSPDADLKGLLQRLETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDMPKGRPNTMNNYG .

• Validation Techniques:

  • Western blot analysis showing a single band at the expected molecular weight

  • Peptide competition assays using the immunizing peptide

  • siRNA knockdown experiments to confirm signal reduction

  • Testing on samples from OGFOD2 knockout models

• Alignment Analysis: Compare the immunogen sequence with other oxygenase family members to identify potential cross-reactivity. Pay particular attention to OGFOD1, which shares structural similarities with OGFOD2.

• Mass Spectrometry Validation: For critical applications, consider immunoprecipitation followed by mass spectrometry to confirm antibody specificity.

What are the advantages and limitations of different OGFOD2 antibody formats?

Different OGFOD2 antibody formats offer distinct advantages and limitations for research applications:

For OGFOD2, most researchers use rabbit polyclonal antibodies , which provide good sensitivity across multiple applications but may show batch-to-batch variability. The selection of antibody format should be guided by the specific experimental requirements, considering factors such as detection method, multiplexing needs, and required sensitivity.

How does OGFOD2's role in iron-dependent oxygenation influence experimental design?

OGFOD2's function as a 2-oxoglutarate and iron-dependent oxygenase has important implications for experimental design:

• Iron Dependency: As an iron-dependent enzyme, OGFOD2 activity can be modulated by iron availability. Researchers studying OGFOD2 function should consider:

  • Controlling iron levels in cell culture experiments

  • Testing iron chelators as modulators of OGFOD2 activity

  • Examining OGFOD2 expression under hypoxic conditions, which often affect iron metabolism

• Co-factor Requirements: The enzyme requires 2-oxoglutarate as a co-substrate, linking it to TCA cycle metabolism. Experimental designs should account for:

  • Potential effects of metabolic perturbations on OGFOD2 function

  • Interactions with other pathways influenced by 2-oxoglutarate levels

  • Use of 2-oxoglutarate analogs as potential inhibitors

• Oxygen Sensing: Many 2OG-dependent oxygenases function as oxygen sensors. Investigators might consider:

  • Examining OGFOD2 expression and activity under varying oxygen tensions

  • Exploring potential interactions with hypoxia-inducible factors

  • Comparing OGFOD2 with better-characterized oxygenases like PHDs or FIH

• Protein Interactions: When designing co-immunoprecipitation experiments, consider that OGFOD2's enzymatic activity may be influenced by protein-protein interactions that could be disrupted by certain lysis conditions.

What are the implications of OGFOD2 in psychiatric research based on current literature?

The search results reference a specific publication linking OGFOD2 to schizophrenia research: "Schizophrenia Working Group of the Psychiatric Genomics Consortium. Biological insights from 108 schizophrenia-associated genetic loci. Nature. 2014 Jul 24; 511(7510):421-7" .

This association suggests several important research directions for investigators using OGFOD2 antibodies in psychiatric research:

• Expression Analysis in Psychiatric Disorders:

  • Examining OGFOD2 protein levels in post-mortem brain samples from schizophrenia patients versus controls

  • Investigating region-specific expression patterns using immunohistochemistry

  • Correlating OGFOD2 levels with disease severity or specific symptom domains

• Genetic Variant Functional Characterization:

  • Studying how schizophrenia-associated variants affect OGFOD2 expression or function

  • Examining whether specific genetic variants alter protein stability or localization

  • Using CRISPR gene editing to model disease-associated variants

• Interaction with Neurodevelopmental Pathways:

  • Investigating OGFOD2's role in neurodevelopment using developmental time course studies

  • Examining interactions with other schizophrenia risk genes

  • Studying OGFOD2 in neural stem cell models

• Potential as a Biomarker:

  • Assessing whether peripheral OGFOD2 levels correlate with CNS expression

  • Evaluating OGFOD2 as a potential diagnostic or prognostic marker

  • Examining OGFOD2 modulation in response to antipsychotic treatment

When designing such studies, researchers should consider using a combination of techniques beyond antibody-based detection, including transcriptomics, proteomics, and functional assays to comprehensively characterize OGFOD2's role in psychiatric disorders.

How can researchers address weak or absent OGFOD2 signal in Western blots?

When encountering weak or absent OGFOD2 signal in Western blot experiments, consider the following systematic troubleshooting approaches:

• Sample Preparation Optimization:

  • Ensure sufficient protein concentration (30-50 μg recommended)

  • Try different lysis buffers (RIPA, NP-40, or specific buffers for nuclear proteins)

  • Add fresh protease inhibitors to prevent degradation

  • Consider phosphatase inhibitors if studying phosphorylated forms

• Antibody-Related Factors:

  • Increase primary antibody concentration (try 1:200 instead of 1:2000)

  • Extend primary antibody incubation time (overnight at 4°C)

  • Verify antibody viability (avoid repeated freeze-thaw cycles)

  • Test alternative OGFOD2 antibodies that recognize different epitopes

• Detection System Enhancement:

  • Use high-sensitivity ECL substrates

  • Consider signal amplification systems

  • Optimize exposure time during imaging

  • Try alternative membrane types (PVDF vs. nitrocellulose)

• Antigen Retrieval Considerations:

  • Reduce sample heating time before loading (some proteins are heat-sensitive)

  • Try native gel conditions if protein conformation is important for recognition

• Expression Level Verification:

  • Confirm OGFOD2 expression in your sample type using qPCR

  • Consider using positive control samples with known OGFOD2 expression

  • Evaluate whether experimental conditions might downregulate OGFOD2

What are the most common pitfalls when using OGFOD2 antibodies in immunohistochemistry?

Immunohistochemical detection of OGFOD2 presents several challenges that researchers should anticipate and address:

• Fixation and Processing Effects:

  • Over-fixation can mask epitopes; optimize fixation time

  • Different fixatives (formalin vs. paraformaldehyde) may affect epitope accessibility

  • Consider using frozen sections if paraffin embedding compromises antigenicity

• Antigen Retrieval Optimization:

  • Test multiple antigen retrieval methods (heat-induced vs. enzymatic)

  • Optimize pH of retrieval buffer (citrate pH 6.0 vs. EDTA pH 9.0)

  • Adjust retrieval time and temperature based on tissue type

• Blocking and Background Issues:

  • Use appropriate blocking sera matched to secondary antibody species

  • Consider specialized blocking for specific tissues (e.g., avidin/biotin blocking for liver)

  • Implement peroxidase blocking steps to reduce endogenous activity

• Antibody Dilution and Incubation:

  • Titrate antibody concentration (recommended range: 1:50 - 1:200)

  • Test both overnight 4°C and room temperature incubation protocols

  • Consider using amplification systems for low-abundance targets

• Tissue-Specific Considerations:

  • Brain tissue may require longer fixation and specialized antigen retrieval

  • High-fat tissues may require modified processing

  • Highly pigmented tissues may need additional steps to reduce background

• Controls and Validation:

  • Always include positive and negative control tissues

  • Use peptide competition controls to confirm specificity

  • Consider dual labeling with markers of subcellular compartments to confirm localization

How can multiplexed detection of OGFOD2 with other proteins be optimized?

Multiplexed detection allows simultaneous visualization of OGFOD2 with other proteins of interest, providing valuable contextual information about co-expression and potential interactions:

• Antibody Selection for Multiplexing:

  • Choose primary antibodies raised in different host species

  • If using same-species antibodies, consider directly conjugated formats

  • Verify that antibodies work under compatible conditions

  • For fluorescent multiplexing with OGFOD2, consider DyLight 594-conjugated antibodies

• Sequential vs. Simultaneous Approaches:

  • For challenging targets, sequential detection with intermittent stripping/blocking may be preferable

  • Simultaneous incubation works well when conditions are compatible

  • Consider tyramide signal amplification for sequential multiplexing

• Spectral Considerations for Fluorescent Detection:

  • Choose fluorophores with minimal spectral overlap

  • Include single-color controls for spectral unmixing

  • Consider spectral imaging systems for resolving closely spaced emissions

• Chromogenic Multiplexing Options:

  • Use different chromogens (DAB, AEC, Fast Red) for distinct visualization

  • Permanent multiplexing requires careful order of detection

  • Consider multi-color IHC kits specifically designed for compatibility

• Protocol Optimization:

  • Optimize antibody concentration for each target individually before multiplexing

  • Adjust blocking conditions to accommodate all antibodies

  • Test for potential cross-reactivity between detection systems

• Analysis Considerations:

  • Implement appropriate controls for bleed-through or cross-reactivity

  • Consider computational approaches for colocalization analysis

  • Use quantitative imaging to assess relative expression levels

How can OGFOD2 antibodies be utilized in studying protein-protein interactions?

Investigating OGFOD2 protein interactions provides valuable insights into its functional networks and regulatory mechanisms:

• Co-immunoprecipitation (Co-IP) Approaches:

  • Use OGFOD2 antibodies for pull-down experiments to identify interaction partners

  • Crosslinking before lysis may preserve weak or transient interactions

  • Consider native IP conditions to maintain physiological protein complexes

  • Reciprocal Co-IP with antibodies against suspected partners can confirm interactions

• Proximity Ligation Assay (PLA):

  • Combines OGFOD2 antibodies with antibodies against potential interactors

  • Provides in situ visualization of protein interactions with spatial resolution

  • More sensitive than traditional co-localization studies

  • Requires careful optimization of antibody dilutions and PLA conditions

• Immunofluorescence Co-localization:

  • Use fluorophore-conjugated antibodies like DyLight 594-labeled OGFOD2

  • Combine with differently labeled antibodies against potential interactors

  • Quantify co-localization using appropriate metrics (Pearson's, Mander's coefficients)

  • Super-resolution microscopy can provide enhanced spatial resolution

• FRET/FLIM Analysis:

  • When using fluorescently labeled antibodies, Förster Resonance Energy Transfer or Fluorescence Lifetime Imaging can assess proximity at molecular scale

  • Requires careful selection of compatible fluorophore pairs

  • Provides evidence of direct interaction (<10 nm proximity)

• Mass Spectrometry Integration:

  • Use OGFOD2 antibodies for immunoprecipitation followed by MS analysis

  • Enables unbiased discovery of interaction partners

  • Consider SILAC or TMT labeling for quantitative interaction proteomics

  • Validate key interactions using orthogonal methods

What are approaches for studying OGFOD2 in the context of oxygen sensing and metabolism?

As a 2-oxoglutarate and iron-dependent oxygenase, OGFOD2 likely functions in oxygen-sensing pathways and metabolic regulation. Researchers can investigate these roles using the following approaches:

• Hypoxia Response Studies:

  • Examine OGFOD2 expression and localization under varying oxygen tensions

  • Compare with established oxygen sensors (PHDs, FIH)

  • Investigate potential interactions with HIF pathway components

  • Use Western blot with OGFOD2 antibodies to quantify protein levels under hypoxia

• Metabolic Context Analysis:

  • Study OGFOD2 in models of altered TCA cycle metabolism

  • Investigate relationships with 2-oxoglutarate levels

  • Examine effects of metabolic perturbations on OGFOD2 function

  • Consider immunoprecipitation followed by activity assays

• Enzymatic Activity Characterization:

  • Develop in vitro enzymatic assays using immunopurified OGFOD2

  • Measure oxygen consumption or 2-oxoglutarate utilization

  • Identify potential substrates through candidate approaches

  • Investigate how post-translational modifications affect activity

• Subcellular Localization Studies:

  • Use immunofluorescence with OGFOD2 antibodies to determine localization

  • Examine changes in localization under metabolic stress

  • Co-stain with organelle markers to precisely define compartmentalization

  • Consider fractionation approaches followed by Western blot

• Functional Genomics Approaches:

  • Combine OGFOD2 knockdown/knockout with metabolomics

  • Perform transcriptomics to identify pathways affected by OGFOD2 modulation

  • Use OGFOD2 antibodies to validate manipulation at protein level

  • Consider rescue experiments with wild-type vs. catalytically inactive mutants

What considerations should be made when studying post-translational modifications of OGFOD2?

Investigating post-translational modifications (PTMs) of OGFOD2 requires specialized approaches beyond standard antibody applications:

• PTM-Specific Antibody Selection:

  • Consider whether available OGFOD2 antibodies recognize modified forms

  • Epitope location relative to potential modification sites is critical

  • Verify whether antibody binding is affected by specific modifications

  • For key modifications, consider generating modification-specific antibodies

• Enrichment Strategies:

  • Immunoprecipitate OGFOD2 using available antibodies

  • Follow with PTM-specific detection methods

  • Consider phospho-enrichment techniques for phosphorylation studies

  • Use PTM-specific affinity resins when available

• Detection Approaches:

  • Western blotting with migration shift analysis

  • Phos-tag gels for phosphorylation studies

  • Mass spectrometry for comprehensive PTM mapping

  • 2D gel electrophoresis for charge-altering modifications

• Functional Correlation:

  • Examine how PTMs affect OGFOD2 enzymatic activity

  • Investigate PTM changes under relevant physiological conditions

  • Consider site-directed mutagenesis to mimic or prevent modifications

  • Study how PTMs affect protein-protein interactions

• Temporal Dynamics:

  • Investigate modification turnover rates

  • Study how modifications respond to cellular stimuli

  • Consider pulse-chase approaches for dynamic studies

  • Examine interdependence between different modification types

When selecting OGFOD2 antibodies for PTM studies, researchers should carefully evaluate whether the epitope region contains potential modification sites and how these modifications might affect antibody recognition.

How might newly developed antibody technologies enhance OGFOD2 research?

Emerging antibody technologies offer significant potential for advancing OGFOD2 research beyond traditional applications:

• Single-domain Antibodies and Nanobodies:

  • Smaller size enables access to sterically hindered epitopes

  • Potential for improved penetration in tissue sections

  • May recognize epitopes not accessible to conventional antibodies

  • Could allow for novel intracellular tracking applications

• Recombinant Antibody Fragments:

  • Precisely engineered specificity for OGFOD2

  • Reduced batch-to-batch variability compared to polyclonal antibodies

  • Potential for site-specific conjugation of labels or functional groups

  • May enable intrabody applications for live-cell tracking

• Spatially-Resolved Antibody Technologies:

  • Integration with spatial transcriptomics for correlative studies

  • Multiplexed antibody imaging with cyclic immunofluorescence

  • Mass cytometry approaches for highly multiplexed detection

  • Advanced in situ proximity labeling techniques

• CRISPR-Based Epitope Tagging:

  • Endogenous tagging of OGFOD2 to circumvent antibody limitations

  • Enables live-cell imaging of endogenous OGFOD2

  • Can be combined with proximity labeling approaches

  • Allows for standardized detection across experimental systems

• Degradation-Targeting Technologies:

  • PROTACs or dTAGs targeting endogenous OGFOD2

  • Enables acute protein depletion with temporal control

  • Can be combined with antibody-based detection for validation

  • Provides functional information complementary to knockout approaches

These emerging technologies will likely complement rather than replace traditional OGFOD2 antibody applications, providing researchers with an expanded toolkit for investigating this protein's functions in various biological contexts.

What are potential applications of OGFOD2 research in disease models beyond schizophrenia?

While current literature links OGFOD2 to schizophrenia , its enzymatic function suggests potential roles in other disease contexts:

• Neurodegenerative Disorders:

  • Investigation in models of hypoxic brain injury

  • Potential roles in protein aggregation disorders

  • Examination of OGFOD2 in relation to metabolic dysfunction in neurodegeneration

  • Use of OGFOD2 antibodies to examine expression changes in disease models

• Cancer Biology:

  • Study of OGFOD2 in hypoxic tumor microenvironments

  • Exploration of connections to altered metabolism in cancer

  • Investigation of potential roles in regulating transcription factors

  • Examination as a potential biomarker using IHC in tissue microarrays

• Metabolic Disorders:

  • Potential roles in sensing nutrient availability

  • Connections to TCA cycle dysregulation

  • Investigation in models of mitochondrial dysfunction

  • Possible links to iron metabolism disorders

• Inflammatory Conditions:

  • Study in models of inflammation-associated hypoxia

  • Potential roles in immune cell metabolism and function

  • Investigation in tissue-specific inflammatory contexts

  • Examination of regulation by inflammatory mediators

• Developmental Biology:

  • Investigation of OGFOD2 in oxygen-dependent developmental processes

  • Study of potential roles in cell fate decisions

  • Examination in models of developmental disorders

  • Analysis of temporal and spatial expression patterns during development

The expanding toolbox of OGFOD2 antibodies enables researchers to investigate this protein's expression and function across these diverse disease contexts, potentially revealing novel pathophysiological mechanisms and therapeutic targets.