OR10S1 Antibody

Antibody Characteristics

The OR10S1 Antibody (e.g., HPA019038 from Sigma-Aldrich) is produced by immunizing rabbits with a synthetic peptide corresponding to the N-terminal region of OR10S1 (immunogen sequence: MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAKHSSL) . Key features include:

• Source: Rabbit polyclonal (affinity-isolated).

• Conjugate: Unconjugated for flexibility in downstream applications.

• Dilution: Recommended for immunohistochemistry (IHC) at 1:50–1:200 .

• Reactivity: Human-specific, with partial identity to mouse and rat orthologs (41%) .

• Storage: −20°C to maintain stability .

A recombinant protein fragment (aa 1–39) is available as a blocking control for specificity validation in IHC and Western blot (WB) .

Validation and Applications

The antibody undergoes rigorous validation through:

• Immunohistochemistry: Tested on tissue arrays of 44 normal and 20 cancer tissues .

• Protein Array: Screened against 364 recombinant human proteins to ensure specificity .

• Blocking Experiments: A recombinant protein fragment (PA5-53901 control) is used to confirm target engagement .

Common applications include:

• Immunohistochemistry: Detects OR10S1 in olfactory epithelium and ectopic tissues .

• Western Blot: Validates protein expression in lysates .

Research Findings

OR10S1 has been studied for its role in odorant recognition and ectopic expression:

• Deorphanization Studies: OR10S1 was identified as a receptor with the broadest ligand profile in a yeast-based screen, responding to 10 distinct chemicals (e.g., lilial, pinene) .

• Expression Patterns: OR10S1 mRNA is detectable in multiple tissues, including liver, testis, and intestine, supporting its role beyond olfaction .

• Signaling Pathway: Activation involves G-protein-mediated calcium signaling, with EC50 values ranging from 107–181 μM for tested ligands .

Clinical and Biomedical Relevance

Olfactory receptors like OR10S1 are emerging targets in:

• Cancer Research: Ectopic expression in leukemia cells (e.g., K562) suggests potential roles in cell proliferation regulation .

• Neurological Disorders: Dysregulation of OR10S1 may contribute to anosmia or neurodegenerative diseases .