OR2T10 Antibody

What is OR2T10 and what biological function does it serve?

OR2T10 (Olfactory Receptor Family 2 Subfamily T Member 10) is a protein involved in olfactory reception. Olfactory receptors interact with odorant molecules in the nose to initiate neuronal responses that trigger the perception of smell . The receptor is also known by alternative names including "olfactory receptor OR1-64" . OR2T10 is a member of the G-protein coupled receptor family that translates chemical signals from odorants into cellular responses. Understanding its structure and function contributes to our knowledge of the molecular basis of olfaction and sensory perception systems.

What are the molecular characteristics of the OR2T10 protein?

The human OR2T10 protein has a molecular weight of approximately 36 kDa . The amino acid sequence (1-100) of human OR2T10 (NP_001004693.1) is MRLANQTLGGDFFLLGIFSQISHPGRLCLLIFSIFLMAVSWNITLILLIHIDSSLHTPMYFFINQLSLIDLTYISVTVPKMLVNQLAKDKTISVLGCGTQ . This sequence information is particularly relevant for researchers designing experiments to detect specific regions of the protein or for generating custom antibodies. The protein functions as a transmembrane receptor, consistent with its role in olfactory signal transduction.

What types of OR2T10 antibodies are currently available for research?

Current research-grade OR2T10 antibodies are predominantly rabbit polyclonal antibodies . These antibodies target various epitopes including the N-terminal region (amino acids 1-100) and internal regions of the OR2T10 protein . The available antibodies are primarily unconjugated, though researchers should verify specific conjugation status for their experimental needs. Polyclonal antibodies against OR2T10 are typically produced by immunizing rabbits with synthetic peptides corresponding to specific sequences of the human OR2T10 protein .

What experimental applications are OR2T10 antibodies validated for?

Based on current validation data, OR2T10 antibodies are primarily validated for Western blotting (WB), enzyme-linked immunosorbent assay (ELISA), and immunofluorescence (IF) . For Western blotting applications, typical recommended dilutions range from 1:500 to 1:2000 . Scientific validation data demonstrates successful detection of OR2T10 in extracts from various cell lines using Western blot analysis . When planning experiments, researchers should review specific validation data for each antibody to ensure compatibility with their experimental design.

How can researchers validate the specificity of OR2T10 antibodies in their experimental systems?

Validating antibody specificity for OR2T10 requires multiple complementary approaches. First, researchers should perform Western blot analysis using positive and negative control samples to confirm band size (approximately 36 kDa) . Inclusion of blocking peptides corresponding to the immunizing sequence can verify binding specificity by competing with target proteins. For genetic validation, researchers should consider using OR2T10 knockdown or knockout cell lines alongside wild-type controls. Cross-reactivity assessment is critical when working with both human and mouse samples, as available antibodies show reactivity to both species . Preabsorption tests using recombinant OR2T10 protein can further confirm specificity by demonstrating signal reduction after antibody pretreatment.

What are optimal sample preparation methods for OR2T10 detection by Western blotting?

For optimal OR2T10 detection in Western blotting, researchers should lyse cells or tissues in a buffer containing appropriate protease inhibitors to prevent protein degradation. Based on product specifications, samples should be denatured in loading buffer containing SDS and reducing agents, then heated at 95°C for 5 minutes . For separation, 10-12% polyacrylamide gels are recommended to resolve the 36 kDa OR2T10 protein efficiently. After transfer to appropriate membranes (PVDF or nitrocellulose), blocking with 5% non-fat milk or BSA in TBST is advised before incubation with primary antibody at recommended dilutions (1:500-1:2000) . Washing steps should be thorough to minimize background signal, and appropriate HRP-conjugated secondary antibodies should be used for detection.

What factors might contribute to inconsistent results when using OR2T10 antibodies?

Several factors may contribute to inconsistency in OR2T10 antibody experiments. First, antibody storage conditions are critical; the available OR2T10 antibodies should be stored at -20°C and repeated freeze-thaw cycles should be avoided . Antibody concentration and incubation time may need optimization for specific experimental systems. Sample preparation issues, including protein degradation or insufficient lysis, can significantly impact results. For membrane proteins like OR2T10, extraction methods should be optimized to effectively solubilize membrane-embedded proteins. Additionally, expression levels of OR2T10 may vary between tissue or cell types, necessitating loading control normalization. Batch-to-batch variation in polyclonal antibodies could also affect experimental reproducibility, requiring validation of new antibody lots.

What protocol is recommended for immunoprecipitation of OR2T10?

For immunoprecipitation of OR2T10, researchers should follow this protocol: Begin by preparing cell lysates in a non-denaturing lysis buffer containing 50 mM Tris-HCl (pH 7.4), 150 mM NaCl, 1% NP-40, and protease inhibitor cocktail. Pre-clear lysates by incubating with protein A/G beads for 1 hour at 4°C. Incubate pre-cleared lysates with 2-5 μg of OR2T10 antibody overnight at 4°C with gentle rotation . Add protein A/G beads and incubate for 2-4 hours at 4°C. Wash immunoprecipitated complexes 4-5 times with cold lysis buffer, then elute proteins by boiling in SDS sample buffer. Analyze by SDS-PAGE and Western blotting using a different OR2T10 antibody than that used for immunoprecipitation to confirm specificity. Include appropriate negative controls such as non-specific IgG to identify non-specific binding.

How should researchers optimize immunofluorescence experiments using OR2T10 antibodies?

For optimal immunofluorescence detection of OR2T10, researchers should fix cells using 4% paraformaldehyde for 15 minutes at room temperature, followed by permeabilization with 0.2% Triton X-100 for 10 minutes . Blocking should be performed with 5% normal serum from the same species as the secondary antibody for 1 hour. Incubate with OR2T10 primary antibody at optimized dilutions (starting with manufacturer recommendations) overnight at 4°C in a humidified chamber . After washing, apply fluorophore-conjugated secondary antibodies for 1-2 hours at room temperature in the dark. Include DAPI for nuclear counterstaining. Mount slides with anti-fade mounting medium and image using confocal microscopy. Control experiments should include secondary-only controls and, if possible, cells with confirmed OR2T10 knockdown to validate specificity.

What controls are essential when using OR2T10 antibodies in experimental setups?

Essential controls for OR2T10 antibody experiments include positive and negative tissue/cell controls with known OR2T10 expression profiles. Antibody specificity controls should include preincubation with immunizing peptide to demonstrate signal reduction. For Western blotting, molecular weight markers are crucial to confirm the expected 36 kDa band size . Loading controls (housekeeping proteins) must be included to normalize protein loading variations. In immunofluorescence or immunohistochemistry, secondary antibody-only controls help identify non-specific binding. When possible, genetic controls (OR2T10 knockdown/knockout) provide the strongest validation of antibody specificity. For cross-reactivity assessment, testing on samples from different species can verify species specificity claims .

What is the recommended protocol for ELISA using OR2T10 antibodies?

For ELISA detection of OR2T10, researchers should coat high-binding 96-well plates with capture antibody (1-10 μg/ml) in carbonate-bicarbonate buffer (pH 9.6) overnight at 4°C . After washing with PBS-T (PBS + 0.05% Tween-20), block with 2-5% BSA or non-fat milk for 1-2 hours at room temperature. Add samples and standards in dilution buffer and incubate for 2 hours at room temperature. Wash thoroughly, then add detection antibody (biotinylated anti-OR2T10 or another OR2T10 antibody that recognizes a different epitope) for 1-2 hours. For colorimetric detection, add streptavidin-HRP followed by TMB substrate. Stop the reaction with 2N H₂SO₄ and read absorbance at 450 nm. Generate a standard curve using recombinant OR2T10 protein to quantify unknown samples. For competitive ELISA formats, researchers should follow specific protocols designed for quantitative competition assays .

How can researchers minimize background signal when using OR2T10 antibodies?

To minimize background signal in OR2T10 antibody experiments, researchers should implement several optimization strategies. For Western blotting, increase blocking time (2-3 hours at room temperature) using 5% non-fat milk or BSA in TBS-T . Dilute primary OR2T10 antibodies in fresh blocking solution and optimize dilutions (starting with 1:1000) . Increase washing frequency (5-6 washes, 5 minutes each) with TBS-T between antibody incubation steps. For immunofluorescence, autofluorescence can be reduced by treating samples with 0.1% sodium borohydride prior to antibody incubation. Using highly cross-adsorbed secondary antibodies minimizes non-specific binding. For all applications, filtration of antibody solutions and blocking reagents helps remove particulates that contribute to background. Finally, storage of diluted antibodies at appropriate temperatures prevents degradation that can lead to non-specific binding.

What steps should be taken to validate a new lot of OR2T10 antibody?

Validating new lots of OR2T10 antibodies requires systematic comparison with previously validated lots. Researchers should perform side-by-side Western blots using positive control samples to compare signal intensity, specificity, and band pattern at the expected molecular weight (36 kDa) . Titration experiments should be conducted to determine if optimal working dilutions differ from previous lots . Immunofluorescence pattern comparison between lots can reveal differences in subcellular localization detection. Epitope blocking experiments using the immunizing peptide should demonstrate similar degrees of signal inhibition between lots. Testing cross-reactivity with related olfactory receptors can confirm maintained specificity. If possible, validation using genetic models (knockdown/knockout) provides definitive confirmation of specificity. Documentation of validation results creates an important reference for future experiments.

How can researchers determine the optimal fixation method for OR2T10 detection in tissue samples?

Determining optimal fixation for OR2T10 detection requires systematic comparison of multiple fixation protocols. Researchers should prepare parallel tissue sections and apply different fixatives including: 4% paraformaldehyde (18-24 hours), 10% neutral buffered formalin (24-48 hours), Bouin's solution (6-12 hours), and methanol/acetone (10 minutes at -20°C). After fixation, process tissues following standard protocols for embedding and sectioning. Perform immunohistochemistry or immunofluorescence using the OR2T10 antibody at consistent dilutions across all fixation conditions . Compare signal intensity, background levels, and morphological preservation. For membrane proteins like OR2T10, mild fixation or specialized membrane-preserving fixatives may better preserve epitopes. Antigen retrieval methods (heat-induced or enzymatic) should be systematically tested to optimize signal recovery after different fixation methods.

How should researchers interpret OR2T10 expression data across different tissues?

Interpretation of OR2T10 expression patterns requires careful consideration of tissue biology and experimental limitations. Researchers should establish baseline expression levels across a panel of normal tissues before assessing expression in experimental conditions. Olfactory epithelium typically shows robust expression, while other tissues may show variable or context-dependent expression . When comparing expression levels between tissues, normalization to tissue-specific housekeeping genes is essential, as global housekeeping genes may vary between tissue types. Semi-quantitative scoring systems should be established for immunohistochemistry data to enable objective comparisons. For transcriptomic analyses, correlation between protein and mRNA levels should be experimentally validated, as post-transcriptional regulation may affect protein abundance. Statistical analysis should account for biological variability in OR2T10 expression within tissue types.

What bioinformatic approaches can help researchers analyze OR2T10 expression and function?

Bioinformatic analysis of OR2T10 can enhance research insights through multiple approaches. Sequence analysis using tools like BLAST can identify conserved domains and motifs across species, providing evolutionary context . Structural prediction algorithms can model the transmembrane topology of OR2T10, aiding understanding of ligand-binding regions. Researchers can leverage public transcriptomic databases (e.g., GTEx, TCGA) to examine OR2T10 expression patterns across tissues and disease states. Network analysis can identify potential interaction partners and signaling pathways connected to OR2T10 function. For researchers investigating genetic variations, tools for predicting functional consequences of SNPs in OR2T10 can prioritize variants for functional validation. Phylogenetic analysis can place OR2T10 in the context of other olfactory receptors, potentially revealing functional relationships.