OR5B3 Antibody

What is OR5B3 and why is it significant in research?

OR5B3 (Olfactory receptor 5B3, also known as OR5B13 or Olfactory receptor OR11-239) is a member of the olfactory receptor family involved in signal transduction pathways. This receptor belongs to the G-protein coupled receptor (GPCR) superfamily, which plays crucial roles in olfactory sensory processes. The significance of OR5B3 in research stems from its involvement in neuroscience and signal transduction pathways, making it valuable for studies on sensory perception, neurological disorders, and GPCR signaling mechanisms. Understanding OR5B3 contributes to broader knowledge of olfactory system function and potential applications in sensory biology research .

What applications are OR5B3 antibodies validated for?

OR5B3 antibodies have been validated for multiple research applications with varying specificity and sensitivity parameters. The primary validated applications include:

For optimal results, researchers should conduct preliminary titration experiments to determine the ideal antibody concentration for their specific experimental system. Application-specific optimization may be necessary depending on sample type, preparation method, and detection system .

How should OR5B3 antibodies be stored to maintain reactivity?

Proper storage of OR5B3 antibodies is critical for maintaining their reactivity and extending their useful lifespan. For short-term storage (up to one month), the antibody can be stored at 4°C. For long-term preservation, aliquot the antibody and store at -20°C, avoiding repeated freeze-thaw cycles that can lead to protein denaturation and functional degradation. OR5B3 antibodies are typically supplied in a stabilizing buffer containing PBS with additives such as 50% glycerol, 0.5% BSA, and 0.02% sodium azide, which helps maintain antibody integrity. When working with the antibody, thaw aliquots completely before use and keep on ice during experimental procedures to prevent degradation .

How should I design a Western blot experiment using OR5B3 antibody?

When designing a Western blot experiment with OR5B3 antibody, follow this methodological approach for optimal results:

• Sample preparation: Extract proteins from human samples using a compatible lysis buffer containing protease inhibitors. Quantify protein concentration using Bradford or BCA assay.

• Gel electrophoresis: Load 20-40 μg of protein per lane on a 10-12% SDS-PAGE gel. Include molecular weight markers to verify the OR5B3 expected size.

• Transfer and blocking: Transfer proteins to PVDF or nitrocellulose membrane, then block with 5% non-fat milk or BSA in TBST for 1 hour at room temperature.

• Primary antibody incubation: Dilute OR5B3 antibody to 1.0 μg/ml in blocking buffer and incubate overnight at 4°C with gentle rocking .

• Secondary antibody and detection: After washing, incubate with HRP-conjugated anti-rabbit secondary antibody at manufacturer-recommended dilution. Develop using chemiluminescence and image appropriately.

• Controls: Include positive control (tissue/cells known to express OR5B3), negative control (tissue/cells not expressing OR5B3), and antibody control (omitting primary antibody) .

What is the recommended protocol for immunofluorescence staining with OR5B3 antibody?

For immunofluorescence staining using OR5B3 antibody, follow this detailed protocol:

• Sample preparation:

  • For cultured cells: Grow cells on coverslips, fix with 4% paraformaldehyde for 15 minutes, permeabilize with 0.2% Triton X-100 for 10 minutes.

  • For tissue sections: Prepare frozen or paraffin sections (4-6 μm thickness), deparaffinize if needed, and perform antigen retrieval if working with paraffin sections.

• Blocking: Incubate samples with blocking solution (5% normal serum from the species of secondary antibody, 1% BSA in PBS) for 1 hour at room temperature.

• Primary antibody: Dilute OR5B3 antibody 1:200-1:1000 in blocking buffer and incubate overnight at 4°C in a humidified chamber .

• Secondary antibody: Wash 3x with PBS, then incubate with fluorophore-conjugated anti-rabbit secondary antibody (1:1000) for 1 hour at room temperature protected from light.

• Counterstaining and mounting: Counterstain nuclei with DAPI (1:5000) for 5 minutes, wash, and mount with anti-fade mounting medium .

• Imaging: Visualize using confocal or fluorescence microscopy, capturing images at appropriate wavelengths for the secondary antibody fluorophore.

How can I optimize ELISA protocols using OR5B3 antibody?

To optimize ELISA protocols with OR5B3 antibody, consider this methodological approach:

• Coating optimization: Test different coating buffers (carbonate buffer pH 9.6, PBS pH 7.4) and coating concentrations (0.5-5 μg/ml of capture antibody or antigen).

• Blocking optimization: Evaluate different blocking agents (1-5% BSA, non-fat milk, or commercial blocking buffers) to minimize background while maintaining specific signal.

• Antibody dilution: Perform a titration series for OR5B3 antibody ranging from 1:1000 to 1:20000, with recommended starting dilution of 1:10000 .

• Sample preparation: Ensure samples are properly prepared and diluted in appropriate buffer with compatible pH and ionic strength.

• Detection system: Choose a detection system (HRP, AP, or fluorescence-based) based on required sensitivity and available equipment.

• Standards and controls: Include a standard curve using recombinant OR5B3 protein and appropriate positive and negative controls to validate assay performance .

• Data analysis: Calculate the limit of detection (LOD) and quantification range to ensure reliable measurements.

What are common issues when using OR5B3 antibody in Western blot and how can they be resolved?

Researchers may encounter several challenges when using OR5B3 antibody in Western blot experiments. Here are common issues and their solutions:

• Weak or no signal:

  • Increase antibody concentration (try 2-5 μg/ml instead of 1 μg/ml)

  • Extend primary antibody incubation time to 24-48 hours at 4°C

  • Verify protein expression in your sample using an alternative method

  • Check if sample preparation preserved the epitope (adjust lysis buffer composition)

  • Consider using enhanced chemiluminescence (ECL) substrate with higher sensitivity

• High background:

  • Increase blocking time or concentration (try 5-10% blocking agent)

  • Use more stringent washing (increase TBST wash steps to 5x10 minutes)

  • Reduce primary antibody concentration

  • Ensure membrane was properly blocked before antibody incubation

  • Try alternative blocking agents (switch between milk and BSA)

• Multiple bands:

  • Optimize SDS-PAGE conditions (adjust acrylamide percentage)

  • Add protease inhibitors to prevent degradation

  • Check for post-translational modifications or isoforms

  • Verify antibody specificity using knockout/knockdown controls

How can I validate the specificity of OR5B3 antibody for my research?

Validating antibody specificity is crucial for producing reliable research data. For OR5B3 antibody, consider these methodological approaches:

• Positive and negative controls:

  • Use tissues/cells known to express OR5B3 (positive control)

  • Use tissues/cells known not to express OR5B3 (negative control)

  • Test in species specified in reactivity data (Human, Rat, Mouse)

• Peptide competition assay:

  • Pre-incubate antibody with immunizing peptide (the synthetic peptide from the C-terminal region of Human OR5B3)

  • Run parallel experiments with blocked and unblocked antibody

  • Signal reduction/elimination confirms specific binding

• Genetic validation:

  • Test in OR5B3 knockout/knockdown models

  • Compare expression patterns with mRNA data (qPCR, RNA-seq)

  • Validate with multiple antibodies targeting different epitopes

• Cross-reactivity assessment:

  • Test for cross-reactivity with closely related olfactory receptors

  • Use epitope sequence alignment analysis to predict potential cross-reactivity

  • Confirm using recombinant protein standards

How should I interpret inconsistent results between different applications (WB vs. IF vs. ELISA)?

When facing inconsistent results across different applications, consider these analytical approaches:

• Application-specific considerations:

  • Western blot detects denatured proteins, so conformational epitopes may be lost

  • IF/ICC preserves cellular context and may detect native conformations

  • ELISA sensitivity varies based on format (direct, sandwich, competitive)

  • Each application exposes different epitopes and has unique detection thresholds

• Methodological troubleshooting:

  • Adjust fixation methods for IF (test both PFA and methanol fixation)

  • Try native vs. reducing conditions for WB

  • Optimize antigen retrieval for tissue sections

  • Adjust antibody concentrations for each application independently

• Data interpretation framework:

  • Consider each method as providing complementary rather than redundant information

  • Use orthogonal approaches to validate findings (e.g., mass spectrometry)

  • Correlate results with functional assays when possible

  • Document application-specific limitations in your research reports

How can OR5B3 antibody be used in co-immunoprecipitation studies to identify protein interaction partners?

Co-immunoprecipitation (Co-IP) with OR5B3 antibody can reveal protein interaction networks essential for understanding olfactory receptor function. Follow this advanced protocol:

• Lysate preparation:

  • Use gentle lysis buffers (e.g., 25 mM Tris-HCl pH 7.4, 150 mM NaCl, 1 mM EDTA, 1% NP-40, 5% glycerol) with protease/phosphatase inhibitors

  • Maintain native protein complexes by avoiding harsh detergents and mechanical disruption

  • Clear lysate by centrifugation (14,000g, 10 minutes, 4°C)

• Pre-clearing:

  • Incubate lysate with Protein A/G beads for 1 hour at 4°C

  • Remove beads to reduce non-specific binding

• Immunoprecipitation:

  • Add 5-10 μg of OR5B3 antibody to 500-1000 μg of pre-cleared lysate

  • Incubate overnight at 4°C with gentle rotation

  • Add pre-washed Protein A/G beads and incubate for 2-4 hours at 4°C

  • Wash 4-5 times with lysis buffer containing reduced detergent

• Elution and analysis:

  • Elute complexes with SDS sample buffer or gentle elution buffer

  • Analyze by SDS-PAGE followed by silver staining, Western blot, or mass spectrometry

• Controls and validation:

  • Include IgG control immunoprecipitation

  • Validate interactions by reverse Co-IP

  • Confirm biological relevance through functional assays

What considerations are important when using OR5B3 antibody in high-content screening applications?

High-content screening with OR5B3 antibody requires careful optimization for robust quantitative analysis:

• Assay development considerations:

  • Optimize cell density, fixation protocols, and antibody concentrations

  • Validate staining patterns across multiple cell types and conditions

  • Establish reproducible positive and negative controls

  • Determine Z'-factor to assess assay quality (aim for >0.5)

• Image acquisition parameters:

  • Standardize exposure times, gain settings, and focus parameters

  • Use appropriate filters to maximize signal-to-noise ratio

  • Capture sufficient fields per well for statistical power

  • Include spatial normalization controls to account for plate position effects

• Analysis pipeline optimization:

  • Define robust cell segmentation algorithms

  • Establish thresholds for positive signals based on controls

  • Develop multi-parametric phenotypic profiles

  • Implement machine learning for complex phenotype recognition

• Data interpretation framework:

  • Account for population heterogeneity in expression patterns

  • Correlate subcellular localization with functional outcomes

  • Integrate results with orthogonal assays

  • Control for off-target effects through secondary validation

How can OR5B3 antibody be applied in single-cell analysis techniques?

Single-cell analysis with OR5B3 antibody provides insights into cellular heterogeneity within olfactory systems:

• Single-cell immunofluorescence:

  • Optimize fixation and permeabilization for single-cell suspensions

  • Implement barcoding strategies for multiplexed analysis

  • Use confocal or super-resolution microscopy for subcellular localization

  • Correlate OR5B3 expression with cell morphology and function

• Flow cytometry applications:

  • Optimize cell preparation and fixation protocols

  • Establish appropriate gating strategies based on controls

  • Consider indirect staining approaches for signal amplification

  • Combine with functional probes to correlate expression with activity

• Mass cytometry (CyTOF) integration:

  • Metal-conjugate OR5B3 antibody according to established protocols

  • Validate specificity and sensitivity of conjugated antibody

  • Develop panels with complementary markers for comprehensive phenotyping

  • Implement dimensionality reduction techniques for data visualization

• Single-cell Western blot considerations:

  • Adapt standard protocols to microfluidic platforms

  • Optimize cell settling and lysis conditions

  • Adjust antibody concentration for reduced volumes

  • Validate detection sensitivity with recombinant standards

How does OR5B3 antibody performance compare to antibodies against other olfactory receptors?

Comparative analysis of OR5B3 antibody with antibodies against other olfactory receptors reveals important considerations for experimental design:

• Cross-reactivity analysis:

  • OR5B3 shows distinct epitope specificity compared to related olfactory receptors like OR5T3

  • Sequence alignment of the immunogen peptide (C-terminal region) with other olfactory receptors reveals minimal overlap, reducing cross-reactivity concerns

  • OR5B3 antibody demonstrates higher specificity compared to broadly reactive olfactory receptor antibodies

• Application versatility comparison:

  • While OR5T3 antibodies are validated for WB and IF/ICC applications in both human and mouse samples , OR5B3 antibodies show species-specific applications with human samples in WB and human/rat/mouse in IF/ELISA

  • This variation necessitates careful antibody selection based on experimental requirements and target species

• Sensitivity benchmarking:

  • Western blot detection limits for OR5B3 (1.0 μg/ml) are comparable to other olfactory receptor antibodies

  • ELISA applications may require higher dilutions (1:10000) compared to IF applications (1:200-1:1000), suggesting differential sensitivity across applications

• Epitope accessibility considerations:

  • The C-terminal epitope of OR5B3 (SSSHSMDTDKMAPVFYTMVIPMLNPLVYSLRNKEVKSAFKKVVEKAKLSV) may have different accessibility compared to epitopes targeted in other olfactory receptor antibodies

  • This impacts application-specific optimization requirements when switching between receptor targets

What are the latest methodological advances in antibody-based detection of olfactory receptors?

Recent methodological advances have enhanced the precision and applications of antibody-based olfactory receptor detection:

• Computational antibody design approaches:

  • Novel computational platforms, similar to those used for viral antibody optimization, can redesign olfactory receptor antibodies with improved specificity and affinity

  • Molecular dynamics simulations using high-performance computing can predict optimal antibody mutations for enhanced target binding

  • These approaches significantly accelerate the development process for highly specific antibodies

• High-throughput screening innovations:

  • Rapid screening capabilities allow evaluation of hundreds of antibody candidates against multiple olfactory receptor variants

  • This enables identification of antibodies with optimal cross-reactivity profiles for specific research applications

  • Combined computational and experimental approaches enhance success rates in antibody development

• Structural biology integration:

  • Advanced structural characterization confirms predicted antibody-antigen interactions

  • This validation ensures consistency between computational design and actual binding mechanisms

  • Integration of structural data improves future antibody design iterations

• Technical optimization paradigms:

  • Minimal protein requirements for characterization (tiny amounts of protein)

  • Enhanced speed and accuracy compared to traditional methods

  • Validated through authentic neutralization assays and in vivo studies where applicable

What experimental considerations are critical when studying OR5B3 in different neural tissues?

When investigating OR5B3 in neural tissues, researchers should consider these tissue-specific methodological approaches:

• Tissue preparation optimization:

  • Olfactory epithelium: Requires specialized fixation (4% PFA, short duration) to preserve delicate architecture

  • Brain sections: May need antigen retrieval optimization (citrate buffer pH 6.0, microwave method)

  • Cultured neurons: Require gentle permeabilization to maintain morphological features

• Background reduction strategies:

  • Autofluorescence in neural tissues can confound IF results

  • Implement Sudan Black B (0.1%) treatment post-fixation

  • Use spectral unmixing during image acquisition

  • Consider tissue-specific blocking agents (5% normal goat serum with 0.3% Triton X-100)

• Co-localization experimental design:

  • Pair OR5B3 antibody with neuronal markers (MAP2, NeuN) and glial markers (GFAP, Iba1)

  • Optimize sequential staining protocols if antibody species conflicts occur

  • Implement rigorous quantitative co-localization metrics (Pearson's coefficient, Manders' coefficient)

  • Control for spectral bleed-through with single-labeled controls

• Functional correlation approaches:

  • Combine immunohistochemistry with electrophysiology or calcium imaging

  • Correlate OR5B3 expression patterns with functional responses to odorants

  • Implement activity-dependent labeling strategies to identify functionally active OR5B3-expressing neurons

  • Consider ex vivo preparations to maintain tissue integrity while enabling functional studies