ddo-3 Antibody

Shipped with Ice Packs
In Stock

Description

Clarification of Terminology

The designation "ddo-3" specifically refers to a gene in Caenorhabditis elegans (C. elegans), as identified in deletion mutants (e.g., ddo-3(tm2028)) . This gene is distinct from the human DDO (D-aspartate oxidase) gene (UniProt ID: Q99489), which encodes a peroxisomal enzyme involved in degrading D-aspartate and N-methyl D-aspartate .

Key distinctions:

  • Human DDO: Well-characterized protein with commercially available antibodies (e.g., Rabbit Polyclonal antibodies from NovoPro , Proteintech , and monoclonal clones from Thermo Fisher ).

  • C. elegans ddo-3: Part of a gene family (ddo-1, ddo-2, ddo-3) implicated in egg-laying and developmental processes, but no antibodies targeting this specific isoform are described in the provided literature .

Human DDO Antibodies: Research Applications and Validation

Antibodies against human DDO are widely used in immunoblotting (WB), immunoprecipitation (IP), and ELISA. Below is a comparative analysis of key reagents:

Key Findings:

  • Specificity: All antibodies recognize human DDO at ~40 kDa . The Thermo Fisher monoclonal antibody (3F7) targets residues within the immunogen sequence WNLSPDAENSREILSRCCAL... .

  • Functional Insights: DDO catalyzes oxidative deamination of D-amino acids, with flavin cofactors (FAD/6-hydroxy-FAD) required for activity .

Technical Performance in Peer-Reviewed Studies

  • Western Blot: NovoPro’s antibody (109774) detects endogenous DDO in SKOV-3 cells at 1:700 dilution . Proteintech’s antibody (13682-1-AP) validates DDO in salivary gland tissues .

  • Immunoprecipitation: Proteintech’s antibody efficiently precipitates DDO from SKOV-3 lysates using 0.5–4.0 µg antibody per 1–3 mg lysate .

Role of DDO in Disease and Therapeutics

While not directly related to "ddo-3", human DDO has therapeutic implications:

  • Vaccine Adjuvants: A 268nt DDO-derived oligonucleotide enhances type-1 immunity in influenza vaccines, synergizing with AddaVax (MF59 analog) to boost IgG2c antibodies and CD8+ T-cell responses .

  • Pathology Modulation: DDO-adjuvanted vaccines reduce mucus-associated pathology (e.g., goblet cell hyperplasia) compared to alum-based formulations .

Limitations and Gaps

  • C. elegans ddo-3: No antibodies targeting this gene product are described in the provided sources. Studies on ddo-3(tm2028) mutants rely on PCR-based genotyping .

  • Species Cross-Reactivity: Most DDO antibodies are validated in humans, mice, and rats , but not in invertebrates like C. elegans.

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
ddo-3 antibody; F20H11.5 antibody; D-aspartate oxidase 3 antibody; DASOX 3 antibody; DDO-3 antibody; EC 1.4.3.1 antibody
Target Names
ddo-3
Uniprot No.

Target Background

Function
DDO-3 Antibody selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate. It exhibits no activity towards L-amino acids or N-methyl-L-aspartic acid. DDO-3 Antibody may play a significant role in egg-laying events and the maturation processes of reproductive organs.
Database Links

KEGG: cel:CELE_F20H11.5

STRING: 6239.F20H11.5

UniGene: Cel.10588

Protein Families
DAMOX/DASOX family
Subcellular Location
Secreted, extracellular space.
Tissue Specificity
Expressed in probable head mesodermal cells and unidentified cells in the head, vulval muscles, hypodermis and the gonad sheath cells in adult hermaphrodites. Also expressed in the seminal vesicle and tail cells in adult males.

Q&A

What is DDO and why are antibodies against it significant in research?

D-aspartate oxidase (DDO) is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. It functions with either flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide as a cofactor in this reaction . DDO antibodies are significant in research because they allow for the detection, quantification, and localization of DDO in various biological samples, supporting studies of peroxisomal function, D-amino acid metabolism, and related neurological processes. Several transcript variants encoding different isoforms have been found for the DDO gene, making antibodies crucial tools for distinguishing between these variants in experimental settings .

What are the primary applications of anti-DDO antibodies in laboratory settings?

Anti-DDO antibodies have diverse applications in laboratory research protocols. Based on validated applications, these antibodies are primarily used in:

  • Western blotting (WB): For detecting and quantifying DDO protein in cell or tissue lysates (typical dilution ranges: 1:100-400 or 1:500-2000 )

  • Immunohistochemistry in paraffin-embedded sections (IHC-P): For visualizing DDO localization in fixed tissues (typical dilution: 1:50-200 )

  • Immunohistochemistry in frozen sections (IHC-F): Alternative to paraffin sections (typical dilution: 1:100-500 )

  • Immunocytochemistry (ICC): For cellular localization studies (typical dilution: 1:100-500 )

  • Enzyme-linked Immunosorbent Assay (ELISA): For quantitative detection (typical dilution: 1:100-200 )

  • Immunoprecipitation (IP): For isolation of DDO from complex protein mixtures

These applications facilitate research into DDO's role in various biological processes and potential involvement in disease states.

What validation methods should researchers employ when using new anti-DDO antibodies?

When introducing a new anti-DDO antibody into your research workflow, comprehensive validation is essential to ensure reliability. A robust validation approach should include:

  • Positive and negative controls: Use tissues or cell lines known to express or lack DDO, respectively. Commercial antibody providers like Boster validate their antibodies against known positive control and negative samples .

  • Multiple technique validation: Verify antibody performance across multiple applications (WB, IHC, ICC, ELISA) to ensure consistent specificity .

  • Comparison with established antibodies: If available, compare results with previously validated anti-DDO antibodies.

  • Blocking peptide controls: Use the immunizing peptide (e.g., E.coli-derived human DDO recombinant protein, Position: M1-P365 ) to confirm binding specificity.

  • Knockout/knockdown controls: If possible, test the antibody in DDO-knockout tissues or DDO-knockdown cell lines.

  • Cross-reactivity testing: Verify species reactivity claims (e.g., human, mouse, rat ) especially when working with less common model organisms.

  • Concentration optimization: Titrate the antibody across the recommended dilution range to determine optimal concentration for your specific application and sample type.

Documentation of these validation steps strengthens the reliability of subsequent experimental results and should be included in publication methods.

How can researchers optimize anti-DDO antibody protocols for challenging experimental conditions?

Optimizing anti-DDO antibody protocols for challenging conditions requires systematic troubleshooting and methodological refinements:

For low-abundance DDO detection:

  • Increase antibody concentration while maintaining specificity (start with manufacturer recommendations, then optimize)

  • Extend primary antibody incubation time (overnight at 4°C rather than 1-2 hours at room temperature)

  • Employ signal amplification systems compatible with your detection method

  • Consider sample enrichment techniques (e.g., immunoprecipitation prior to Western blot)

For high background issues:

  • Increase blocking stringency using 5% BSA or 5% non-fat milk in PBS with 0.1% Tween-20

  • Include additional washing steps with higher detergent concentrations

  • Titrate your secondary antibody to find optimal concentration

  • Pre-absorb antibody with non-specific proteins if cross-reactivity is suspected

For fixed tissue samples:

  • Optimize antigen retrieval methods (heat-induced vs. enzymatic)

  • Test different fixation protocols if working with fresh samples

  • Reduce section thickness for better antibody penetration

  • Extend washing steps to remove fixative residues

Successful optimization should be documented with clear protocols that specify exact conditions for reproducibility in future experiments.

What are the critical considerations when using anti-DDO antibodies in multi-parameter immunofluorescence studies?

When designing multi-parameter immunofluorescence experiments incorporating anti-DDO antibodies, several critical factors must be addressed:

Antibody compatibility:

  • Ensure primary antibodies originate from different host species to prevent cross-reactivity

  • If using multiple rabbit-derived antibodies (like many anti-DDO antibodies ), employ sequential staining with direct labeling of the first primary antibody

Spectral considerations:

  • Select fluorophores with minimal spectral overlap

  • Include appropriate single-stained controls for spectral compensation

  • Consider the recommended concentration for immunofluorescence applications (0.25-2 μg/mL for some anti-DDO antibodies )

Signal optimization:

  • Balance signal intensity across all markers by adjusting antibody concentrations

  • Account for DDO's reported peroxisomal localization when interpreting colocalization data

  • Include appropriate subcellular markers to confirm expected DDO distribution patterns

Controls:

  • Include blocking peptide controls to verify specificity

  • Use isotype controls to assess non-specific binding

  • Employ FMO (fluorescence minus one) controls in complex panels

These considerations help ensure reliable multi-parameter analysis when incorporating DDO detection into complex immunofluorescence experiments.

How do polyclonal and monoclonal anti-DDO antibodies compare in terms of research applications?

The choice between polyclonal and monoclonal anti-DDO antibodies significantly impacts experimental outcomes, with each offering distinct advantages:

CharacteristicPolyclonal Anti-DDO AntibodiesMonoclonal Anti-DDO Antibodies
SourceTypically rabbit-derived Limited commercial availability
Target epitopesMultiple epitopes (e.g., immunogen sequence MLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTE or full-length protein)Single epitope
SensitivityHigher sensitivity due to multiple epitope recognitionMay have lower sensitivity but higher specificity
Batch consistencyVariation between lots requires validationConsistent performance between lots
ApplicationsVersatile; effective in multiple applications (WB, IHC, ICC, ELISA) Application-specific optimization may be required
Recommended forInitial characterization studies, detection of denatured proteins in WBPrecise epitope mapping, standardized assays requiring consistency
LimitationsHigher background in some applications, batch variabilityMay be affected by epitope masking or modification

What methodological approaches can resolve discrepancies in anti-DDO antibody results between different experimental systems?

When encountering discrepancies in anti-DDO antibody results across different experimental systems, a systematic investigative approach is required:

  • Antibody characterization verification:

    • Confirm antibody specificity using Western blot to verify molecular weight (approximately 37.5 kDa )

    • Test with recombinant DDO protein as a positive control

    • Consider testing multiple anti-DDO antibodies targeting different epitopes

  • Sample preparation assessment:

    • Compare protein extraction methods (consider that DDO is peroxisomal)

    • Evaluate fixation and epitope retrieval protocols for microscopy applications

    • Test both reducing and non-reducing conditions for Western blotting

  • Cross-system standardization:

    • Implement a common positive control across all experimental systems

    • Standardize antibody concentrations using titration curves for each system

    • Normalize quantitative data to housekeeping proteins or loading controls

  • Technical validation:

    • Compare results using orthogonal methods (e.g., mass spectrometry)

    • Verify with genetic approaches (siRNA knockdown or CRISPR knockout)

    • Consider RNA-seq data to correlate with protein detection results, as used in enhanced validation approaches

  • Experimental documentation:

    • Maintain detailed records of exact protocols, reagent lots, and equipment settings

    • Document all method optimization steps and validation results

    • Consider publishing detailed methods papers when introducing new DDO detection protocols

This methodological framework helps distinguish true biological differences from technical artifacts when comparing DDO expression or localization across experimental systems.

What are the optimal storage and handling conditions to maintain anti-DDO antibody activity?

Proper storage and handling of anti-DDO antibodies is crucial for maintaining their activity and extending their useful lifespan:

Short-term storage (working solutions):

  • For antibodies stored in PBS with NaN₃ and glycerol formulations , maintain at 2-8°C for up to 6 months after reconstitution

  • Avoid repeated freeze-thaw cycles which can denature the antibody protein

  • Store working dilutions at 4°C for no more than one week

  • Add sodium azide (0.02%) to prevent microbial contamination in working solutions

Long-term storage:

  • Store at -20°C in the supplied buffer (typically PBS, pH 7.4, containing 0.02% NaN₃, 50% glycerol )

  • Original manufacturer vials can typically be stored for 12 months from date of receipt at -20°C

  • Aliquot into small volumes before freezing to minimize freeze-thaw cycles

  • Label aliquots with antibody details, concentration, and date

Handling recommendations:

  • Centrifuge briefly before opening vials to collect liquid at the bottom

  • Use sterile techniques when handling antibody solutions

  • Avoid contamination with bacteria or fungi

  • Transport on ice when moving between storage and experimental areas

Quality control measures:

  • Periodically test antibody activity on known positive controls

  • Document lot numbers and purchase dates

  • Maintain a log of freeze-thaw cycles and storage conditions

  • Consider including stabilizing proteins (BSA) in working dilutions

Following these storage and handling guidelines helps ensure consistent antibody performance throughout your research project.

What controls are essential when using anti-DDO antibodies in different experimental applications?

Implementing appropriate controls is essential for ensuring reliable results when using anti-DDO antibodies across various experimental applications:

For Western Blotting:

  • Positive control: Recombinant DDO protein or lysate from tissues known to express DDO

  • Negative control: Lysate from tissues or cell lines with minimal DDO expression

  • Loading control: Housekeeping protein (e.g., β-actin, GAPDH) to normalize DDO expression

  • Primary antibody control: Omit primary antibody but include secondary antibody

  • Molecular weight marker: Verify the expected 37.535 kDa size of DDO

For Immunohistochemistry/Immunocytochemistry:

  • Positive tissue control: Section from tissue known to express DDO

  • Negative tissue control: Section from tissue with minimal DDO expression

  • Antibody controls:

    • Primary antibody omission control

    • Isotype control (irrelevant antibody of same isotype)

    • Blocking peptide control (pre-incubate antibody with immunizing peptide)

  • Autofluorescence control: Unstained sample to assess natural fluorescence (for fluorescent detection)

For ELISA:

  • Standard curve: Serial dilutions of recombinant DDO protein

  • Blank wells: Complete reaction without sample

  • Background control: All reagents except primary antibody

  • Specificity control: Competition with free antigen

  • Intra-assay replicates: Technical triplicates to assess precision

For Immunoprecipitation:

  • Input control: Aliquot of pre-IP lysate

  • IgG control: Non-specific IgG from same species as DDO antibody

  • Beads-only control: Precipitation matrix without antibody

  • Reverse IP: Immunoprecipitate with antibody against known DDO-interacting protein

What are the recommended protocols for using anti-DDO antibodies in Western blotting?

A detailed Western blotting protocol for optimal detection of DDO using specific anti-DDO antibodies should include the following methodological steps:

Sample preparation:

  • Prepare tissue/cell lysates in RIPA buffer supplemented with protease inhibitors

  • Determine protein concentration (BCA or Bradford assay)

  • Prepare samples at 20-50 μg total protein per lane

  • Add reducing sample buffer (containing DTT or β-mercaptoethanol)

  • Heat samples at 95°C for 5 minutes

Gel electrophoresis:

  • Load samples and molecular weight marker on 10-12% SDS-PAGE gel (appropriate for 37.5 kDa DDO protein )

  • Run at 100-120V until adequate separation (approximately 1-1.5 hours)

Transfer:

  • Transfer proteins to PVDF or nitrocellulose membrane (PVDF recommended for enhanced sensitivity)

  • Transfer at 100V for 1 hour or 30V overnight at 4°C

  • Verify transfer efficiency with reversible protein stain (Ponceau S)

Blocking and antibody incubation:

  • Block membrane with 5% non-fat milk or 5% BSA in TBST for 1 hour at room temperature

  • Incubate with primary anti-DDO antibody at recommended dilution:

    • 1:100-400 dilution or

    • 1:500-2000 dilution in blocking buffer

  • Incubate overnight at 4°C with gentle rocking

  • Wash 3-5 times with TBST, 5 minutes each

  • Incubate with HRP-conjugated secondary antibody (anti-rabbit IgG for rabbit polyclonal DDO antibodies ) at 1:5000-1:10000 dilution for 1 hour at room temperature

  • Wash 3-5 times with TBST, 5 minutes each

Detection:

  • Apply ECL substrate for standard detection or enhanced chemiluminescent substrate for greater sensitivity

  • Use 5 μL per well of control when using enhanced chemiluminescent (ECL) detection

  • Image using chemiluminescence imaging system

  • Analyze band at approximately 37.5 kDa representing DDO protein

Optimization notes:

  • If background is high, increase washing duration or detergent concentration

  • If signal is weak, increase antibody concentration, extend incubation time, or use signal enhancement systems

  • For reprobing, strip the membrane with commercial stripping buffer for 15 minutes at room temperature

This protocol provides a foundation that can be optimized for specific experimental requirements and antibody characteristics.

How can researchers effectively troubleshoot non-specific binding issues with anti-DDO antibodies?

When encountering non-specific binding with anti-DDO antibodies, a systematic troubleshooting approach can resolve these issues:

Diagnostic assessment:

  • Characterize the pattern of non-specific binding (multiple bands, high background, unexpected cellular localization)

  • Compare observed results with expected DDO molecular weight (37.535 kDa ) and subcellular localization (peroxisomal)

  • Review all positive and negative controls to confirm specificity issues

Western blotting optimization strategies:

  • Increase blocking stringency:

    • Extend blocking time to 2 hours or overnight at 4°C

    • Test alternative blocking agents (milk vs. BSA vs. commercial blockers)

    • Increase blocking agent concentration (from 5% to 10%)

  • Antibody optimization:

    • Further dilute primary antibody (test series from 1:500 to 1:5000)

    • Reduce incubation temperature (4°C instead of room temperature)

    • Pre-absorb antibody with tissue/cell lysate from negative control samples

  • Washing modifications:

    • Increase wash duration and frequency (5× for 10 minutes each)

    • Increase detergent concentration in wash buffer (0.1% to 0.3% Tween-20)

    • Include salt gradient washing steps

Immunohistochemistry/Immunocytochemistry optimization:

  • Fixation considerations:

    • Test different fixatives (paraformaldehyde vs. methanol)

    • Optimize fixation duration

    • Evaluate antigen retrieval methods (citrate vs. EDTA buffers)

  • Blocking improvements:

    • Include serum from secondary antibody host species

    • Add protein blockers (Fish gelatin, casein)

    • Block endogenous peroxidases/phosphatases more thoroughly

  • Detection refinements:

    • Reduce substrate development time

    • Use more specific detection systems

    • Consider fluorescent secondary antibodies for cleaner signal

Advanced validation:

  • Perform peptide competition assays using the immunogen sequence

  • Test antibody on tissue from DDO knockout models

  • Compare with orthogonal methods (mass spectrometry, in situ hybridization)

Systematic documentation of each troubleshooting step creates valuable laboratory protocols for consistent DDO detection across experiments.

What are the key specifications of commercially available anti-DDO antibodies?

The following table summarizes key specifications of commercially available anti-DDO antibodies based on the search results:

SpecificationSigma-Aldrich Anti-DDO Polyclonal Anti-DDO Boster Bio Anti-DDO
Host organismRabbitRabbitRabbit
ClonalityPolyclonalPolyclonalPolyclonal
FormBuffered aqueous glycerol solutionSolution in PBS, pH7.4, containing 0.02% NaN₃, 50% glycerol500 μg/ml antibody with PBS, 0.02% NaN₃, 1 mg BSA and 50% glycerol
Target speciesHumanHumanHuman, Mouse, Rat
ApplicationsImmunofluorescence: 0.25-2 μg/mL; Immunohistochemistry: 1:500-1:1000WB: 1:100-400; ICC: 1:100-500; IHC-P: 1:50-200; IHC-F: 1:100-500; ELISA: 1:100-200WB: 1:500-2000; IP; ELISA
ImmunogenMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTERecombinant DDO (Val117~Glu199) expressed in E.coliE.coli-derived human DDO recombinant protein (Position: M1-P365)
Validation methodsIndependent, orthogonal RNAseqQuality control with recombinant DDOWB, IHC, ICC, Immunofluorescence, and ELISA
Storage recommendation-20°CPBS, pH7.4, containing 0.02% NaN₃, 50% glycerol12 months from date of receipt, -20°C as supplied. 6 months 2 to 8°C after reconstitution
Molecular weightNot specifiedNot specified37.535 kDa

These specifications provide researchers with important considerations for selecting the appropriate anti-DDO antibody based on their specific experimental requirements, target species, and preferred applications.

How does DDO function as an adjuvant in mRNA vaccine development?

Recent research demonstrates that DDO, specifically the viral-derived oligonucleotide DDO268, functions as an effective adjuvant in mRNA vaccine development through several immunological mechanisms:

Immune sensing and activation pathway:

  • DDO268 is recognized by RIG I-like receptors when co-packaged with mRNA in lipid nanoparticles

  • This recognition triggers local type I interferon (IFN) production, a key initiator of immune responses

  • The IFN production leads to activation of dendritic cells type 1 (DC1)

  • Activated dendritic cells migrate to draining lymph nodes, initiating adaptive immune responses

Enhanced immune response characteristics:

  • Improved generation of IgG2c antibodies, indicating a Th1-skewed humoral response

  • Enhanced development of antigen-specific Th1 CD4+ T-cells (IFNγ+TNFα+IL2+)

  • Increased production of antigen-specific effector CD8+ T-cells (IFNγ+TNFα+IL2+)

  • Both cellular and humoral immunity are enhanced, providing more comprehensive protection

Practical advantages in vaccine development:

  • Reduction in required antigen dose for effective protection

  • Enhanced protection against lethal viral challenge in animal models

  • Particularly effective for viral targets requiring both neutralizing antibodies and cytotoxic T-cell responses

  • Potentially applicable to other mRNA vaccine platforms beyond influenza models

This adjuvant approach represents a significant advancement in mRNA vaccine technology, particularly for targeting conserved viral epitopes where both antibody and T-cell responses are required for optimal protection.

What advances in de novo antibody design are relevant to developing new anti-DDO antibodies?

Recent advances in computational antibody design methodologies offer promising approaches for developing next-generation anti-DDO antibodies with enhanced properties:

SE(3) diffusion models for antibody design:

  • Novel computational approaches like IgDiff use protein backbone diffusion frameworks extended to handle multiple chains

  • These models can generate highly designable antibody structures with novel binding regions

  • The backbone dihedral angles of structures produced show good agreement with reference antibody distributions

  • Experimentally validated antibodies designed through these methods show high expression yields

Advantages for anti-DDO antibody development:

  • Potential to design antibodies targeting specific epitopes of DDO with enhanced specificity

  • Ability to generate complementarity determining regions (CDRs) optimized for DDO binding

  • Computational pairing of heavy and light chains for optimal binding characteristics

  • Improved designability properties compared to traditional methods

Implementation considerations:

  • These computational approaches require high-quality structural data on DDO protein

  • Validation through experimental testing remains essential

  • Integration with existing antibody development workflows requires technical expertise

  • Cost-benefit analysis compared to traditional hybridoma or phage display methods

These computational design approaches represent a frontier in antibody engineering that could yield anti-DDO antibodies with superior properties for research applications, potentially addressing current limitations in specificity, affinity, or cross-reactivity.

What are the emerging trends and future directions in DDO antibody research?

The field of DDO antibody research is evolving rapidly, with several emerging trends and future directions that researchers should consider:

  • Enhanced validation approaches: The move toward more rigorous antibody validation using orthogonal methods (RNAseq) , independent validation, and reproducibility testing across laboratories will strengthen the reliability of DDO detection.

  • Therapeutic applications: The development of DDO-adjuvanted vaccines highlights potential therapeutic applications, suggesting possible development of DDO-targeting antibodies for therapeutic purposes.

  • Computational design: Advances in computational antibody design using SE(3) diffusion models may lead to next-generation anti-DDO antibodies with superior specificity, affinity, and reduced cross-reactivity.

  • Multi-omics integration: Combining DDO antibody-based proteomics with transcriptomics and metabolomics will provide more comprehensive understanding of DDO's biological roles.

  • Standardization initiatives: The development of reference standards and standardized protocols for DDO detection will improve cross-study comparability.

  • Single-cell applications: Adaptation of anti-DDO antibodies for single-cell proteomic approaches will enable more detailed analysis of DDO expression heterogeneity.

  • Engineered antibody formats: Development of recombinant antibody fragments, nanobodies, or other engineered formats may provide new tools for DDO research with improved tissue penetration or intracellular delivery.

As these trends develop, researchers should stay informed about new validation standards, technical innovations, and emerging applications that may enhance the utility of DDO antibodies in both basic and translational research contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.